KEGG   Ursus arctos horribilis: 113253997Help
Entry
113253997         CDS       T05909                                 

Gene name
NMNAT3
Definition
(RefSeq) nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3 isoform X1
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
uah  Ursus arctos horribilis
Pathway
uah00760  Nicotinate and nicotinamide metabolism
uah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    113253997 (NMNAT3)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     113253997 (NMNAT3)
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     113253997 (NMNAT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 113253997
NCBI-ProteinID: XP_026352925
UniProt: A0A3Q7VL59
Position
Unknown
AA seq 264 aa AA seqDB search
MKSRIPVVLLACGSFNPITNMHLRLFEVARDHLHQTGMYQVIGGIISPVNDNYRKKDLVA
AHHRVAMARLALQTSDWVRVDPWESEQVQWMETVKVLRHHHSELLRSLPQMEGLDHGRAR
STAPTAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGVVCVSRMGHNPKEYISGSP
ILHRYRHNIHLAREPVQNELSSTYVRRALSQGHSVKYLLPDAVITYIKDHNLYTRDGSCK
GSGTQRNEGKTSWGEPATPPRSSS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaagagccgaatcccagtggtgctcctggcctgtggctccttcaatcccatcaccaac
atgcatctgcgcttgtttgaggtggccagagaccacctacatcaaacaggaatgtaccag
gtgatcgggggtatcatctctcctgtcaacgacaactacaggaagaaagacctcgtggct
gcccaccaccgggtggccatggcccggctggccctgcagacgtccgactgggtccgggtg
gacccctgggagagtgagcaggtgcagtggatggagacagtgaaggtgctgaggcatcat
cacagcgaactgctcagatctctgccccagatggaaggcctggaccacggcagggctcgc
agcacggcccccacagctgtgcccgagctgaagctcctctgcggggcagacgtcctgaag
accttccagacccccaacctctggaaagacgcacacatccaggagatagtggagaagttt
ggcgtggtgtgcgtgagccggatgggccacaacccgaaggagtacatctcgggctcgccc
atcctgcaccggtaccggcacaacattcacctggccagggagcccgtgcagaatgagctc
agctccacatacgtcaggcgggccctgagccagggccacagcgtgaagtacctgctccca
gacgctgtcatcacctacatcaaggaccacaacctctacaccagggacggttcctgcaaa
ggcagtggcacccagaggaatgaaggaaagacaagctggggagagcccgccactcctcca
cggagctcctcctga

DBGET integrated database retrieval system