KEGG   Ursus arctos horribilis: 113254653Help
Entry
113254653         CDS       T05909                                 

Gene name
CPT2
Definition
(RefSeq) carnitine O-palmitoyltransferase 2, mitochondrial
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
uah  Ursus arctos horribilis
Pathway
uah00071  Fatty acid degradation
uah01212  Fatty acid metabolism
uah03320  PPAR signaling pathway
uah04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    113254653 (CPT2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    113254653 (CPT2)
  09159 Environmental adaptation
   04714 Thermogenesis
    113254653 (CPT2)
Enzymes [BR:uah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     113254653 (CPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf Tri3 WES_acyltransf Cohesin_HEAT
Motif
Other DBs
NCBI-GeneID: 113254653
NCBI-ProteinID: XP_026353848
UniProt: A0A3Q7VY68
Position
Unknown
AA seq 659 aa AA seqDB search
MVACLLLLRAWPRGPAVGPGPLCRPLSSGSGSREYLQRSIVPTMHFQDSLPRLPIPKLED
TMKRYLRAQKPLLDDGQFRKTEQFCKSFENGVGKDLHEQLVAQDKQNKHTSYISGPWFDM
YLTARDSVVLNFNPFLAFHPDPKSEYNDQLTRATNMTVSALRFLKTLRAGLLEPEVFHLN
PAKSDTDTFKRLIRFVPSSLSWYGAYLVNAYPLDMSQYFRLFNSTRLPRPTRDELVTDEK
ARHLLVLRKGHFYVFDVLDQDGNIVSASEIQAHLKYILSDNSPAPEFPLAYLTTENRDVW
ADLRQKLVSGGNEETLRKVDSAVFCLCLDDFPIKGLIHLSHSMLHSDGTNRWFDKSFNLI
IAQDGTAAIHFEHAWGDGVAVLRFFNEVFKDSTQAPAISPQSQPARTDSSAAVQRLNFKL
NDALKTGISTAKEKFDATVKTLTVDFIRFYRGGKEFLKEQKLSPDSVAQLAFQMAFLRQY
GQTVATYESCSTAAFKHGRTETIRPASIFTKRCSEAFVREPSQHSAGELQQMMAECSKYH
GQLTKEAAMGQGFDRHLFALRYLAAAKGIVPPELYLDPAYGQINHNILSTSTLSSPAVNI
GGFAPVVPDGFGIGYTVHDNWIGCNVSSYPGRNAREFLQCVEKALEDIFDALEGQCIKT
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggtggcctgcctgctgctgctgcgcgcctggccccggggccctgcagttggcccggga
cccctgtgtcggccccttagctcaggctcggggtcccgcgagtacctgcagcgcagcatc
gtgcccactatgcacttccaggacagcctgcccaggctgcctattcccaagcttgaagac
accatgaagagatacctccgtgcgcagaagcctctcttagatgatggccaattcaggaaa
acagaacagttttgcaagagttttgaaaacggggttggaaaagacctgcacgaacagctg
gttgctcaggacaagcagaataaacatacgagctacatttcaggcccctggtttgatatg
tacctaactgctcgagactccgttgtcttgaactttaatccattcctggcattccaccct
gacccaaagtctgagtataatgaccagctcaccagggcaaccaacatgactgtttctgcc
ctccggtttctgaagacacttcgggctggtcttttggagccagaggttttccacttgaac
cctgctaaaagtgacactgacaccttcaagagactcatacgctttgtgccttcctccctg
tcctggtacggtgcctatttggttaatgcgtaccccctggatatgtcccagtattttcgg
cttttcaattcaactcgtttacccagacccactcgggatgaacttgttactgatgagaag
gctaggcacctcctggtcctaagaaaaggacatttctatgtttttgatgtcctggatcaa
gatggaaacattgtgagcgcctctgaaatccaggctcatctgaagtacattctctcagac
aacagccctgcccccgaatttcccctggcgtatctgaccactgagaaccgagacgtctgg
gcagacctcaggcagaagctggtgagtggtggcaatgaggagaccctgaggaaggtggac
tctgccgtgttctgcctctgcctagatgacttccccattaagggcctcatccacttgtct
cacagcatgctgcacagtgacggcacaaaccgctggttcgataagtccttcaacctcatt
atagcccaggacggcactgccgccatccacttcgagcatgcttggggcgacggtgtggca
gtgctcaggtttttcaatgaagtgttcaaagatagcactcaggcccctgctatcagccca
cagagccagccagcccgcactgactcttctgctgccgtgcaaagacttaacttcaagctg
aacgacgccttgaagactggcatcagcactgctaaggaaaagtttgatgccaccgtgaaa
accctcactgtcgacttcatccggttttacagagggggcaaagagttcttgaaggagcag
aagctgagtcctgactcggtagctcagctggccttccagatggccttcctgcggcagtac
gggcagacggtggccacctacgagtcctgtagcactgccgcattcaagcatggccgcacc
gagaccattcgcccggcctccatcttcacgaagaggtgttctgaggcctttgtcagggag
ccctcccaacacagtgctggagagcttcagcagatgatggccgagtgctccaagtaccat
ggccagctgaccaaagaagcagcgatgggccagggctttgatcgacacttatttgctctg
cggtacctggcagcagccaaggggattgttccacctgagctatacctggaccctgcgtat
gggcagataaaccacaacatcctgtccacgagcacgctgagcagcccagcagtgaacatc
gggggctttgcccctgtggtccctgatggctttggcattgggtataccgttcacgacaac
tggataggctgcaacgtctcctcctacccaggccgcaatgcccgggagtttcttcagtgt
gtagaaaaggccttagaagacatatttgatgccttagaaggccaatgcatcaaaacttag

DBGET integrated database retrieval system