KEGG   Ursus arctos horribilis: 113255064
Entry
113255064         CDS       T05909                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
uah  Ursus arctos horribilis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:uah01002]
    113255064 (ERAP1)
Enzymes [BR:uah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     113255064 (ERAP1)
Peptidases and inhibitors [BR:uah01002]
 Metallo peptidases
  Family M1
   113255064 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 113255064
NCBI-ProteinID: XP_026354364
UniProt: A0A3Q7WJK1
Position
Unknown
AA seq 942 aa
MISLSIKWPLATMLFLPSSLLILLTVSTRSWCQSSDAMSPKASNGTPFPWEKMRLPEHII
PVHYDLLIHANLTTLTFEGTTEIEITASQPTSTIILHSHRLQISKATLKKRDGERLSAEP
LTVLEYPAHEQIALLAPEPLVVGLPYVVVIDYAGHLSEHLQGFYKSTYRTKEGEVRVLAS
THFEPTAARMAFPCFDEPAFKANFSVKIRREPRHLAISNMPLVKSVTVAEGLLEDHFAVT
VKMSTYLVAFIISDFKSISKMTKSGVKVSIYAVPDKIHQADYALDTAVTLLEFYEDYFRI
PYPLPKQDLAAIPDFESGAMENWGLTTYRESILLFDAEKSSASDKLGITMTVSHELAHQW
FGNLVTMEWWNDLWLKEGFAKFMEFVSVSVTHPELKVGDYFLGKCFDVMELDALNSSHPV
STAVENPAQIREMFDEVSYKKGACILNMLRDYLSAEAFKSGVVRYLQKYSYKNTRNEDLW
NSMASICPADDSQSMDGFCSRGPHSSSASHWRQEGLDVKTMMNTWTLQKGFPLITVTVRG
KNVHVRQELYRKGPEDASETGYLWHVPLTFITSKSDSIQRFLLKTKTDVLILPEEVEWIK
FNVGMNGYYIVHYEDDGWDSLTGLLTVAHTTISSNDRASLINNAFQLVSNGKLSIEKALD
LTLYLKRETEIMPVFQGLNELIPMYKLMEKRDMNEVENQFKAFLIRLLSDLIDNQTWTDE
GSVSQRMLRSQLLLLACVRKYQPCVQRAEAYFREWKDADGNLSLPSDVTLAVFAVGVQDP
EGWDFLYRKYQSSLSSSEKNKIEFALSISQDKDKLQWLLEESFKGDVIKIQEFPHILGAI
GRNPVGYPLAWQFLRENWDKLIQKFELGSASLTYMVIGTTSQFSTRARLEEVKEFFSSLK
EKGSQLRCVQQTIETIGENIRWMDKNFEKIRVWLQSEKLELL
NT seq 2829 nt   +upstreamnt  +downstreamnt
atgatatctctgtccatcaaatggccactggcaaccatgctgtttctaccgtcctcgctg
ttgattctcttaactgtgtcaactcgttcctggtgtcagagcagtgacgctatgtctcca
aaagctagtaatgggactccattcccttgggagaaaatgcggcttcctgagcacatcatc
ccggttcattatgatctcctgatccatgcaaatctcaccactctgactttcgagggaacc
acggaaatcgaaatcacagccagccagcctactagtaccatcatcctgcacagtcaccgc
ctgcaaatatctaaggccaccctcaagaagagagacggggagaggctgtctgcagaacca
ttgaccgtcctggaatacccggctcatgagcagatcgcacttctggcccccgagcctctg
gttgttgggcttccgtatgtcgtcgtcatcgactacgctggccatctttctgagcacttg
caaggattttataaaagcacctacagaaccaaggaaggcgaagtgagagtgcttgcatca
acacactttgaacccactgcagcgagaatggcgtttccctgctttgatgaacccgccttc
aaagcgaatttttcagtcaagatcagaagggagccaagacacctcgccatctccaatatg
ccgctggttaagtctgtgactgtcgccgaaggactcctcgaagaccattttgctgttact
gtgaagatgagcacctacctcgtggccttcattatctcagactttaagtctattagcaag
atgaccaagagcggagtcaaggtttccatatatgctgtgcctgacaagatacatcaggca
gattatgccctggataccgcagtgactcttctagaattttacgaggattatttcaggatt
ccatatcccttacccaaacaagatcttgctgccattcctgactttgagagcggtgctatg
gaaaactggggactgaccacatacagagaatctattctcttgtttgacgctgagaagtct
tctgcgtcggataagcttggcattacgatgacggtgtcgcatgaactcgcccaccagtgg
tttgggaacctcgtcaccatggaatggtggaatgatctttggttaaaagagggatttgcc
aagtttatggagtttgtgtccgtcagtgtgactcatcctgaactgaaagttggagattat
ttcctcggcaagtgttttgacgtgatggagctggatgcgttaaattcgtcacaccctgtg
tccacagctgtggagaatcctgctcagattcgcgagatgtttgatgaggtttcttataaa
aagggagcttgtattctgaatatgctaagggattatctcagtgccgaagcatttaaaagc
ggtgttgtacgttatctccagaagtacagctacaaaaacacgagaaatgaggacctgtgg
aacagtatggcaagtatttgccctgcagatgactcacagagcatggacggcttttgctcc
aggggtccacattcatcttcagcctcacactggcggcaggaaggccttgacgtaaaaacc
atgatgaacacgtggacgctgcagaaaggctttcccctgataaccgtcacggtgagaggg
aagaacgtacacgtgaggcaggagctctacaggaaaggacccgaggacgcctcagaaact
gggtacctgtggcatgttccattgaccttcattaccagcaaatcagactccatccaaaga
tttttgctgaagacaaaaacagatgtgctcatcctcccagaagaggtagaatggatcaaa
tttaatgtcggaatgaacggctattacattgtgcattacgaggatgacggatgggattct
ttgactggccttttaacagtagcacacacgacaatcagcagcaacgatcgggccagtctc
atcaacaatgcatttcagctcgtcagcaatggaaagctgtcaattgaaaaagccttggat
ttaaccctgtacttgaaacgtgaaactgaaatcatgccggtgttccaaggtttgaatgag
ctgatacctatgtataagttgatggagaaaagagatatgaatgaagtggaaaatcaattc
aaggcctttctcatcaggctgctgagcgacctcattgacaatcagacgtggacggacgag
ggctcagtctcccagcgaatgctgcgcagtcagctgctgctgctcgcctgtgtgcgcaaa
tatcagccctgcgtgcagagggcggaagcctatttcagagagtggaaggacgccgatggg
aatctgagcctgcccagcgatgtgaccttggcagtgtttgctgtgggggtccaggaccct
gaaggatgggattttctttatagaaaatatcagtcgtctctgtcttcttccgagaaaaat
aaaattgaatttgccctcagtattagccaagataaggacaagcttcagtggctactagaa
gaaagttttaagggagatgtaataaaaattcaagagtttccacatattcttggagctatt
ggcaggaacccggtgggatatccattggcctggcagtttctgagggaaaattgggataaa
ctgatacaaaagtttgaacttggctcagcttccctaacctatatggtgataggaacaacg
agtcagttctccacaagagcacggcttgaagaggtaaaagaattcttcagctctttgaaa
gaaaagggttctcagctacgttgtgtccagcaaacaattgaaaccattggggaaaacata
cgttggatggataagaactttgagaagatccgagtgtggctacaaagcgagaagcttgaa
ctgctctaa

DBGET integrated database retrieval system