KEGG   Ursus arctos horribilis: 113256460
Entry
113256460         CDS       T05909                                 

Gene name
RDH5
Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
uah  Ursus arctos horribilis
Pathway
uah00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113256460 (RDH5)
Enzymes [BR:uah01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     113256460 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR
Other DBs
NCBI-GeneID: 113256460
NCBI-ProteinID: XP_026356113
UniProt: A0A3Q7W4A9
Position
Unknown
AA seq 318 aa
MWLPLLLGVLLWAALWLLRDHQSLPASDAFIFITGCDSGFGRLLALRLDQRGFRVLASCL
TPSGAEDLQRVASSRLHTTLLDVTDPQSVQRAAKWVETHVGEAGLFGLVNNAGVAGIIGP
TPWLTQNDFRRVLNVNTLGPVGVTLALLPLLQRARGRVVNVTSVLGRLAANGGGYCVSKF
GLEAFSDSLRRDVAHFGVRVSIVEPGFFQTSVTNLKCLEDTLQECWARLPPTTQALYGEA
FLTRYLEVQQRVMNLISDPDLTKVSRCLEHALTARHPRTRYSPGWDAKLLWLPASYLPAS
LVDAVLTWVLPKPAQAVC
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggctgcctctgctgctgggagtcctgctctgggcggcgctgtggttgctcagggac
caccagagcctgcccgccagcgacgctttcatcttcatcaccggctgcgactcaggcttc
gggcggcttttggcactgagactggaccagagaggcttccgagtcctggccagctgcctg
accccctcgggggcagaggacctacagcgggtggcctcctcccgcctccacaccaccctg
ctggatgtcactgatccccagagtgtccagcgggcagccaagtgggtggaaacacacgtc
ggggaagcagggctttttggtctggtgaataacgctggtgtggccgggatcatcgggccc
acaccgtggctcacacagaatgatttccgtcgggtgctgaacgtgaatacactgggtccc
gtcggcgtcaccctcgccctgctgccactgctgcagcgggcccggggccgggtggtcaac
gtcaccagtgttctgggtcgcctggcagccaatggcgggggctactgtgtctccaagttt
ggcctggaggccttctctgacagcctgaggcgggatgtggctcattttggggtccgagtc
tccatcgtggagcctggcttcttccagacctctgtgacaaatctcaagtgtttggaggac
acactgcaggagtgctgggcacggctacctcccaccacacaggccctctatggggaggcc
ttcctcaccagatacttggaagtgcagcagcgcgtcatgaacctgatcagtgacccggac
ctgaccaaggtgagcaggtgcctggagcacgccctgactgctcgccacccgagaacccgg
tacagcccaggctgggacgctaagctgctctggctgccggcctcctacctgccagccagc
ctggtggacgctgtgctcacctgggtccttcccaaacctgcccaggcggtctgctga

DBGET integrated database retrieval system