KEGG   Ursus arctos horribilis: 113257629
Entry
113257629         CDS       T05909                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X1
  KO
K04829  acid-sensing ion channel 1
Organism
uah  Ursus arctos horribilis
Pathway
uah04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:uah00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    113257629 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:uah04040]
    113257629 (ASIC1)
Ion channels [BR:uah04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   113257629 (ASIC1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 113257629
NCBI-ProteinID: XP_026357690
UniProt: A0A3Q7VY83
Position
Unknown
AA seq 560 aa
MPIQIFCSVSFSSGEEAPGPLGDVWGPQQRRRQRDNSESEEEEEEKEKEAVRKAAREGDS
PVDLVAFANSCTLHGASHIFVEGGPGPRQALWAVAFVLALGAFLCQVGDRVAYYLSYPHV
TLLDEVATTELAFPAVTLCNANAVRLSQLSYPDLLYLAPMLGLDESDDPGVPLAPPGPEA
FSGEPFNLHRFYNRSCHRLEDMLLYCSYCGGPCGPHNFSVVFTRYGKCYTFNSGRDGRPR
LKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVA
PGFQTFVSCQEQRLIYLPPPWGTCKAVTMDSDFFDSYSITACRIDCETRYLVENCNCRMV
HMPGDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAK
YLAKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGASIL
TVLELFDYAYEVIKHKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESLRGHPAGMT
YAANILPHHPARGTFEDFTC
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgcccatccagattttctgctctgtgtccttctcctctggagaggaggccccagggccc
ttgggagatgtttggggtccccagcagcggcggcggcagcgggacaactcagaatcagaa
gaggaggaggaagagaaggaaaaggaggcagtgaggaaggcggctagagagggggattca
cccgtggatttggtggcctttgccaacagctgcaccctgcacggcgccagtcacatcttc
gtggaggggggtccgggcccgaggcaggccctgtgggcagtggcctttgtcctggcactg
ggcgccttcttgtgccaggtgggggaccgcgtcgcctattacctcagctacccgcacgtg
actctgctggacgaggtggccaccacggagctggccttcccagccgtcaccctctgcaac
gctaatgccgtgcgcctgtcccagctcagctaccccgacttgctctacctggcccccatg
ctggggctggacgaaagtgatgaccctggggtgcccctcgcccccccggggcccgaggcc
ttctctggggagccctttaacctgcaccgcttctacaatcgctcctgccaccggctggag
gacatgctgctctattgctcctactgtggggggccctgtggccctcacaacttctcagtg
gtcttcacacggtatggcaagtgctacacattcaactctggccgagatgggcgtccacgg
ctgaagaccatgaagggtgggactggcaatgggctggagatcatgctggacatccagcag
gacgagtacctgcctgtatggggagagactgatgagacgtccttcgaagcgggcatcaaa
gtgcagatccacagtcaggatgaacctcccttcatcgaccagctgggctttggtgtggcc
ccagggttccagacctttgtgtcctgccaggagcagcggctcatctacctgcccccgccc
tggggcacctgcaaagctgttaccatggactcggatttcttcgactcctacagcattact
gcctgccgcatcgactgtgagacacgctacctggtggagaactgtaactgtcgcatggtg
cacatgccaggggatgccccatactgcactccggaacagtacaaggagtgtgcggatcct
gctctagacttcctggtggagaaggaccaggagtactgtgtgtgtgaaatgccatgcaac
ctaacccgctatggcaaggagctgtccatggtcaagatccccagcaaagcatcagccaag
tacctggccaagaagttcaacaagtctgagcagtacataggggagaacatcctggtgctg
gacattttctttgaagtcctcaactatgagactattgagcagaagaaggcctatgaaatt
gcagggctcctgggtgacattgggggccaaatggggctgttcattggggccagcatcctc
acggttctggagctcttcgactacgcttatgaggtcattaagcacaagctgtgcagaaga
ggaaagtgccagaaggaggccaaacggagcagcgctgataagggtgtggcccttagcctg
gatgacgtcaaaagacataacccgtgtgagagcctccggggccaccccgctgggatgacg
tatgctgccaacatcctacctcaccatccggcccgaggcacttttgaggactttacctgc
tga

DBGET integrated database retrieval system