KEGG   Ursus arctos horribilis: 113260215Help
Entry
113260215         CDS       T05909                                 

Gene name
GUCY1A2
Definition
(RefSeq) guanylate cyclase soluble subunit alpha-2
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
uah  Ursus arctos horribilis
Pathway
uah00230  Purine metabolism
uah01100  Metabolic pathways
uah04022  cGMP-PKG signaling pathway
uah04270  Vascular smooth muscle contraction
uah04540  Gap junction
uah04611  Platelet activation
uah04713  Circadian entrainment
uah04730  Long-term depression
uah04921  Oxytocin signaling pathway
uah04924  Renin secretion
uah04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    113260215 (GUCY1A2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    113260215 (GUCY1A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113260215 (GUCY1A2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    113260215 (GUCY1A2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    113260215 (GUCY1A2)
   04924 Renin secretion
    113260215 (GUCY1A2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    113260215 (GUCY1A2)
  09154 Digestive system
   04970 Salivary secretion
    113260215 (GUCY1A2)
  09156 Nervous system
   04730 Long-term depression
    113260215 (GUCY1A2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    113260215 (GUCY1A2)
Enzymes [BR:uah01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     113260215 (GUCY1A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Motif
Other DBs
NCBI-GeneID: 113260215
NCBI-ProteinID: XP_026361742
UniProt: A0A3Q7XGT8
Position
Unknown
AA seq 908 aa AA seqDB search
MDRNSPTSRPQASPRWLQREVFRPRPAPLSRTAPRAARPLLGCLSSGPGLGCLGLGPFGL
IQATVRSSSEEGKVGAGRAHRGRQPSVLVAPETWRQARQRLAMSMMATRDAGGGSAWAGG
TIKGEGGRRAARGERREARGGRREGKGGEIGARAAEALPPGPHGPQLRRPAVRGRTLAAA
LRAGARRTARRPGERRGGAARAAAEAAAAPSPARRRRRARAPSSRHEQPPLRAPRLRGLP
PGRARPQSPGAPTRLTPPPGGPNAAAAASISRLTAPSPQTIQQTLKRTLQYYEHQVIGYR
DAERNFHNISNRCSYADYSNKEEIEDVSGILQCTANILGLKFEEIQERFGEEFFNICFDE
NERVLRAVGGTLQDFFNGFDALLEHIRTSFGKQAALESPSFLCKELPEGALMLHYFHPHR
TVGFAMPGMIKAAAKKIYRLDVAVEQVASEKLGSDASNPGNCGCLTFLIKECDDTNITKN
LPQGTSQVPADLRISISTFCRAFPFHLMFDPHMSVLQLGEGLRKQLRCDTHKVLKFQDCF
EIVSPRVHAAFERVLLRLSTPFVIRTKPEASGTEHKDKVMEVKGQMIHVPESNSILFLGS
PCVDKLDELMGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLERTHQALE
EEKKKTVDLLYSIFPGDVAQQLWQGQQVQARKFDDVTMLFSDIVGFTAICAQCTPMQVIS
MLNELYTRFDHQCGFLDIYKVETIGDAYCVAAGLHRKSLCHAKPIALMALKMMELSEEVL
TPDGRPIQMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRINVSPTTYQ
LLKREESFTFVPRSREELPDNFPKEIPGICYFLEVRTGPKQPKPSLSSSRIKKVSYNIGT
MFLRETSL
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atggaccgtaactcccccacttcgcgccctcaggcttccccgaggtggctccagagggag
gtcttccgccctcgccccgcgcccctctcccgcacagcacccagagcggcccgaccgctc
ctcggctgcctctccagcggaccagggctggggtgtttggggctggggccctttggcctg
atccaagccaccgtgcgctcctcctcggaggaggggaaggtgggagcggggagggcgcac
agaggacggcaaccaagtgtcctcgttgctcctgaaacgtggcgacaggcgaggcagaga
ctcgcaatgagtatgatggcgacacgtgatgccggcggagggagcgcatgggcggggggg
acgataaagggagaaggagggaggcgggcagcaaggggagagaggcgggaggcgaggggc
gggaggagagaggggaaggggggcgagatcggcgcgcgggcggcagaagctctgcctccc
ggaccgcacgggccgcagctccgccgccccgccgtccgcggtcgcacactcgcagccgcc
ctgcgagcgggagcgcggcgcactgccaggcgcccaggcgagcgcagaggcggcgccgcg
cgagcagcagcggaggcggcggcggcccctagcccagcccggcgccgccgccgcgcccgg
gccccaagttcccgccatgagcagccgcctctgcgggctccgcggctccggggactccct
cccggccgggcgcgaccgcagagccccggggccccgacgcgcctaacgccgccgcccggc
ggtcccaacgccgctgccgccgccagcatcagccgcctaacggcgccctcgcctcagaca
atacagcagactctcaagaggaccctgcagtattacgagcaccaagttattggttacagg
gatgcagaaaggaatttccacaatatctccaacagatgctcctatgcagactattccaac
aaagaggaaattgaagacgtctcaggaattcttcagtgcactgctaatatactcggtttg
aagtttgaggaaatccaagaaagatttggcgaggagttctttaatatatgcttcgatgag
aacgagagagtccttcgagctgtgggcggcacgttgcaggatttttttaatggctttgat
gctttgttggaacacattagaacttcttttgggaaacaggcggctctggagtcgccatcg
ttcctgtgcaaagagctccctgaaggcgcgctgatgctccactatttccaccctcaccgt
accgtggggtttgcaatgccggggatgatcaaggccgcagccaagaagatctacaggctg
gacgtggcggtggagcaagttgccagcgagaagctgggctctgatgcttcgaacccgggc
aactgcggctgtcttaccttcctcatcaaagaatgtgacgacaccaacatcacaaagaac
cttccccagggcacctcccaggtccccgcagacctcagaatcagcatcagcaccttctgt
agagccttccctttccacttgatgtttgacccccacatgtctgtgctccagctgggggaa
ggcctgcggaagcagctgcgctgcgatactcacaaagtgctcaagttccaggactgcttc
gagatcgtgtctcccagggttcatgccgccttcgagagggtcctgctgcgcctgtccacc
ccattcgtgatcaggaccaagcccgaggcttctggcactgaacacaaagacaaggtgatg
gaagtcaaaggacagatgatccatgtcccggaatcaaattccatcttattcttgggctct
ccgtgcgtggacaagctggatgagctcatgggccgagggctgcatctctcagacatcccg
atccatgacgccacccgagacgtcattctggttggtgagcaggcaaaggcacaggatggc
ttgaagaagaggatggataaactaaaggcaactttggaaagaactcaccaggccctggaa
gaagaaaaaaagaaaacagtagatcttctatattctattttccccggtgacgttgcccag
cagttgtggcaaggacagcaggtgcaggccaggaagtttgacgacgtcaccatgctcttc
tcagacattgtcggcttcacggccatctgtgcccagtgtacccccatgcaggtgatcagc
atgctgaatgaactgtacaccaggtttgaccaccagtgcggatttctggatatttataag
gtggaaacaataggtgatgcgtactgtgttgctgcaggactccataggaaaagcctctgc
catgctaagcccattgctctgatggccctcaagatgatggaactttcagaagaggtgctg
acacctgatggaagaccaattcagatgaggataggcattcactcgggttccgtgctcgct
ggagttgttggggtgagaatgccacgatattgcctgtttggaaataatgtcactctggca
agcaaattcgaatcaggaagtcaccctcggcgcatcaatgtcagccccaccacttaccaa
ttattaaaacgggaagaaagtttcacattcgttcctcggtcccgtgaagagcttccagat
aactttccaaaggaaatccctgggatctgctatttcctggaggtaaggactggtcctaag
cagccaaagccttctctttcctcctcgaggataaaaaaagtttcctacaacatcggcacc
atgttcctccgggagacaagcctctga

DBGET integrated database retrieval system