KEGG   Ursus arctos horribilis: 113260394Help
Entry
113260394         CDS       T05909                                 

Gene name
ERP44
Definition
(RefSeq) endoplasmic reticulum resident protein 44
  KO
K17264  endoplasmic reticulum resident protein 44
Organism
uah  Ursus arctos horribilis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113260394 (ERP44)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113260394 (ERP44)
Membrane trafficking [BR:uah04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    113260394 (ERP44)
Exosome [BR:uah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113260394 (ERP44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin_6 Thioredoxin Calsequestrin OST3_OST6 Thioredoxin_2 HyaE Thioredoxin_8
Motif
Other DBs
NCBI-GeneID: 113260394
NCBI-ProteinID: XP_026361922
UniProt: A0A3Q7XHD3
Position
Unknown
AA seq 489 aa AA seqDB search
MTYSVRVVQDYISQYAPRWAGPGNEGVRGLSGSCPGCSRLELRVQRTRSCCREDRPLPPA
PGAQPFPNPTQPCPVPAANPGVTMNPAVFLSLPDLRCSLLLLVTWVFTPVTTEITSLDTE
NIDDILNNADVALVNFYADWCRFSQMLHPIFEEASNVIKEEYPNENQVVFARVDCDQHSD
IAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPVQELHDLAEITTLD
RSKRNIIGYFEQKDSENYRVFERVANILHDDCAFLSAFGAVSKPERYSGDNIIYKPPGHS
APDMVYLGSMTNFDGTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLE
IFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFRD
VLIPGKLKQFVFDLHSGKLHREFHHGPDPTDIAPGQPVQDVASSPPESSFQKLAPSEYRY
TLLRDRDEL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgacgtactcagtgagagtggtgcaggactacatttcccaatatgctccgaggtgggca
ggacccggaaatgagggtgtgcgaggcctctctggaagttgtcccgggtgttcgcggctg
gagctccgggtccagaggacgaggtcctgctgccgggaggatcgtccgctgccgccggct
cccggagcccagccctttcctaacccaacccaaccctgcccagtcccagccgcaaacccc
ggcgttaccatgaatcctgccgtcttcctatccttacccgacctcagatgctccctgctg
ctcctggtaacctgggtttttactcctgtaacaactgaaataacaagtcttgatacagag
aatatagatgacattttaaacaatgctgatgttgctttagtaaatttttatgctgactgg
tgtcgtttcagccaaatgttgcatccaatttttgaggaagcttctaatgtcattaaggaa
gaatatccaaatgaaaatcaagtagtgtttgccagagttgattgtgatcagcactctgat
atagcccagagatataggataagcaaatacccaaccctcaaattatttcgtaatgggatg
atgatgaagagagaatacaggggccagcggtcagtgaaagctcttgcagattacatcagg
caacaaaaaagcgaccccgttcaagaacttcatgacttagcagaaatcaccactcttgat
cgcagcaaaagaaatatcattggatattttgagcaaaaggattcagaaaactatagagtt
tttgaaagagtagcaaatattttgcacgatgattgtgccttcctttctgcatttggagct
gtttcaaaaccagaaagatatagtggcgacaacataatctacaaaccaccggggcattct
gctccagatatggtatacttgggatctatgacaaatttcgatgggacttacaattggatt
caggataaatgcgttcctcttgttcgagaaataacatttgaaaatggagaggaactgaca
gaagaaggactgccttttctcatacttttccacatgaaagaagatacggaaagtttagaa
atattccagaatgaagtagcccgacaattaataagtgaaaaaggtacaataaacttttta
catgctgactgtgacaaatttcgacaccctcttctgcacatacagaaaactccagcagat
tgccctgtcatagctattgacagctttaggcatatgtatgtgtttggagacttcagggat
gtattaattcctggaaaactcaagcagttcgtatttgacttacattctggaaaattgcac
agagaattccatcatggtcctgacccaaccgatatagccccaggacagccagtccaagac
gtagcaagcagtccacctgagagctccttccagaaattagcacccagcgaatataggtat
actttactgagggatcgagatgagctttaa

DBGET integrated database retrieval system