KEGG   Ursus arctos horribilis: 113260772
Entry
113260772         CDS       T05909                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
uah  Ursus arctos horribilis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:uah03000]
    113260772 (AHRR)
Transcription factors [BR:uah03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    113260772 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 113260772
NCBI-ProteinID: XP_026362405
UniProt: A0A3Q7WC14
Position
Unknown
AA seq 821 aa
MELSGRFYIRKRKPVGSEVQGHKGEGWEEEEDPPQTPPREGARGPCQRNSPARTLMQQTA
LWYLSCVYCSWMPIEWLLLSEHRLRIFIYRPEMMIPPGECMYAGRKRRKPIQKQRPAMGA
EKSNPSKRHRDRLNAELDHLASLLPLPPDIVSKLDKLSVLRLSVSYLRVKSFFQAVQKCP
RTPAASAPSPAPSAEDSGLSGRSAVLEGRLLLESLDGFALVVSAEGMIFYASATIVDYLG
FHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQVVFGQPLHSETGGSLEDAVLGRLLR
AQEGGAGSPTDFSAFLTRCFVCRVRCLLDSTSGFLTMQFQGKLKFLFGQKRKTPSGIVLP
PRLSLFCIVVPVLLPSVAEMKMKSAFLRVKHRVDVSASMDAKARVAASQCDPEFRGKPSY
FAGRNNGENIPVLRTQADTGRWARVPARAPCLCLRNGPDLISDPEGAPGDRGGEEHGRVP
GVSSAARGRREIHAHSCCFEAPGPVKHLSWMTGRHGQDGGSKLKLEPSRSDPFSMHAVSL
GSCAPCPGVQGAVNTSGVTAFRNPPSCHPGSNSPSAYASRTSRALRDSDQGQAHPPPSCP
FPRGSLDSGLPQPRGQRLTAAGYSIEDTKFRGGPVPSGAPCNPILSLDVPIKMESDSGSE
DATDGYSLSPRQAWLGASGMAKRQLVTFPTRMHLKTEPEAKHHLYAPHLEHSLLEAHPSV
RAPLRPGRELAPFHPAHCACLERGHGLPEPDPPHHFCAQGHQPPTLGCDCRAPGTAPIVK
REPLDSPPWASHSQGGVPGMFPKSAVATLMPPKAPECAFLP
NT seq 2466 nt   +upstreamnt  +downstreamnt
atggagttgagtgggagattttacatacgaaagaggaagcctgttggctcagaagtacag
ggccataaaggggagggttgggaagaggaagaagacccaccacaaacaccaccaagagag
ggtgcacgcggcccctgccagaggaacagccccgccagaacgctgatgcagcaaactgct
ctttggtaccttagctgtgtgtactgctcgtggatgcccatagaatggcttctactttct
gagcacaggctcaggatatttatctaccggccagagatgatgatcccaccaggggagtgc
atgtatgctggaaggaaaagaaggaagcccattcagaaacagaggcctgccatgggggct
gagaagtcaaacccttccaagcggcaccgggaccgtctcaacgccgagctggaccacctg
gccagcctactgcctcttcctccagacatcgtgtctaagctggacaagctttccgttctg
cgtctcagtgtcagctacctcagggtgaagagcttcttccaagccgtgcagaagtgtcca
cggacgccggcggccagtgccccctcacctgccccctcagccgaagacagcggtctgagc
ggaagatccgcggtgctggagggaaggctgctgctggagtctctcgatggcttcgccctg
gtcgtgagtgcggaaggcatgatattttatgcttcagcaacaatcgtggactatctgggc
ttccaccagaccgatgtgatgcaccaaaacatttacgactacatccacgtggacgaccgc
caggacttctgccggcagctccactgggccatggaccctccccaggtggtgtttgggcag
cccctgcactcagagacaggtgggtctttggaggacgccgtcctggggaggctgctgcgc
gcgcaggagggaggcgcgggctcgcccacggacttctcggccttcctgacgcgctgcttc
gtgtgccgcgtgcgctgcctgctggacagcacctcgggctttctgacgatgcagtttcaa
ggaaaactaaaattcctgtttggacagaagaggaaaacgccatcagggatagtcctgccc
cctcggctctcactgttctgcatcgtggtgcctgtcctcctaccttccgtggcggagatg
aaaatgaagagtgcgtttttgagggtgaagcacagggtggacgtctcagcctcgatggat
gcaaaagcaagagtggccgcgagtcagtgcgacccagaattccgtgggaaacccagttac
ttcgcagggaggaacaacggagaaaacattccagtgctcaggacacaagcggacacggga
cgctgggcccgggttccagccagggccccatgcctgtgcctcagaaatggccccgacctc
atttctgaccctgaaggggccccaggggacaggggaggagaagagcacggcagggtgccc
ggcgtctcctcagcagccagggggcggagggaaatacatgcacacagttgctgcttcgag
gcacccggacccgtgaagcacctgagctggatgacggggcgacacggccaggacgggggc
agcaagctgaagctggagcccagcaggagtgacccgttctccatgcatgctgtgtccctt
ggctcctgcgcgccctgcccaggcgttcagggtgccgtcaacaccagtggggtaactgct
ttcaggaatccccccagctgtcacccaggaagcaattctcccagcgcctatgccagccgc
accagcagagctttgcgggacagcgatcagggccaggcgcaccctccacccagctgcccc
ttcccccgggggagcctggacagtgggctccctcagcccagagggcaacgtctcacagcg
gcgggctattccatcgaggacaccaagtttcgaggtgggccagtgccctcgggagctccg
tgcaaccccatcttgtcacttgatgtgcccatcaagatggagagtgactctgggtctgag
gatgccacagatggctactccctatccccgcgccaggcgtggctgggagccagcggtatg
gccaagagacagctggtcactttccctaccaggatgcacctgaaaacagagccggaagcc
aagcaccacctgtacgctccgcacctggagcacagcttgttggaggctcacccgagcgtc
agggctccactcagacctggcagggagctggcccccttccaccccgcgcactgtgcctgc
ctggagcgtgggcatggccttcctgagccagatcctccccaccacttctgtgcacagggt
caccagccccccacactgggctgtgactgccgagctccggggactgcgcccatcgtcaaa
cgggagcccctggactccccgccatgggccagtcacagccagggcggggtgcccggaatg
ttccccaaaagtgccgtggcaacgctgatgcctcctaaagcccccgagtgtgctttcctg
ccataa

DBGET integrated database retrieval system