KEGG   Ursus arctos horribilis: 113261259Help
Entry
113261259         CDS       T05909                                 

Gene name
XPO5
Definition
(RefSeq) exportin-5 isoform X1
  KO
K14289  exportin-5
Organism
uah  Ursus arctos horribilis
Pathway
uah03013  RNA transport
Brite
KEGG Orthology (KO) [BR:uah00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    113261259 (XPO5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:uah03016]
    113261259 (XPO5)
   03036 Chromosome and associated proteins [BR:uah03036]
    113261259 (XPO5)
Transfer RNA biogenesis [BR:uah03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    113261259 (XPO5)
Chromosome and associated proteins [BR:uah03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     113261259 (XPO5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xpo1 IBN_N
Motif
Other DBs
NCBI-GeneID: 113261259
NCBI-ProteinID: XP_026363155
UniProt: A0A3Q7WE36
Position
Unknown
AA seq 1200 aa AA seqDB search
MAMDQVNALCEQLVKAVTVMMDPSSTQRYRLEALKFCEEFKEKCPICVPCGLRLAEKTQI
AIVRHFGLQILEHVVKFRWNSMSRLEKVYLKNSVMELIANGTLDILEEENHIKDVLSRIV
VEMIKREWPQHWPDMLIELDTLSKQGETQTELVMFILLRLAEDVVTFQTLPPQRRRDIQQ
TLTQNMEKIFSFLLNTLQENVNKYRQAKTDNSQESKAQANCRVGVAALNTLAGYIDWVSM
SHITAENCKLLEMLCLLLNEQELQLGAAECLLIAVSRKGKLEDRKPLMVLFGDVAMHYIL
SAAQTADGGGLVEKHYVFLKRLCQVLCALGNQLCALLGVDSDVETPANFGKYLESFLAFT
THPSQFLRSSTQMTWGALFRHEILSRDPLLLAIIPKYLRASMTNLVKMGFPSKTDSPSCE
YSRFDFDSDEDFNAFFNSSRAQQGEVMRLACRLDPKTSFQMAGEWLKYQLSTSVDTGSMN
SGTGEGALCSIFSSSFVQWEAMTFFLESVVNQMFRTLDKEAVPVNDGIELLQMVLNFDTK
DPLILSCVLTNVSALFPFVTYRPEFLPQVFSKLFSSVTFETVEESKAPRTRAVRNVRRHA
CSSIIKTCRDYPQLVLPNFDMLYNHVKQLLSNELLLTQMEKCALMEALVLISNQFKSYER
QKVFLEELMAPVASIWLSEDMHRVLSDVDAFIAYVGADRKSCDPGPEDPCGLNRARMSFC
VYSILGVVKRTCWPTDLEEAKAGGFVVGYTPSGNPIFRNPCTEQILKLLDNLLALIRTHN
TLYAPEMLAKMSEPFTKALDMLEAEKSAILGLPQPLLELNDSPVYKTVLERMQRFFCTLY
ENCFHILGKAGPSMQQDFYSVEHLATQLLSSAFVNLNNIPDYRLRPMLRVFVKPLVLFCP
PEHYGALVSPILGPLFTYLHMRLSQKWQVINQRSLLCGEDDTADDNPESQEMLEEQLVRM
LTREVMDLITVCCVSKKSADHGTAPPTDGDDEEMMATEVAPSTMTELTDLGRCLMNHEDV
CTALLITAFNSLAWKDTLSCQRTTTQLCWPLLKQVLSGTLLADAVTWLFTSVLKGLQTHG
QHDGCMASLVHLAFQIYEALRPRYLEIRAVMEQIPDIQKDSLDQFDCKLLNPSLQKVADK
RRKDQFKRLIAGCIGKPLGEQFRKEVHIKNLPSLFKKTKPMLETEVLDNEEGGLATIFEP
NT seq 3603 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggatcaagtgaacgcgttgtgtgagcagctggtgaaagcggtgacggtcatg
atggaccccagctccacccagcgctaccggctggaagccctcaagttttgtgaagagttt
aaagaaaagtgccctatctgtgtcccctgtggcttgaggttggctgagaagacacaaatt
gccatcgtcagacattttggccttcagatcctggaacacgttgtcaagtttcggtggaac
agcatgtctcgattggagaaggtctatctgaagaacagtgtcatggagctgattgcaaat
ggaacactggatattttggaagaggaaaaccatattaaagatgttttgtctcgaattgta
gtagaaatgatcaagcgggagtggccacagcactggcctgatatgctaatagaactggat
accctttccaaacaaggggaaacacagacagaattagtgatgtttatccttttacgactg
gcagaggatgtagtgacctttcagacactaccccctcaaagaagaagggatatccagcaa
acattaacccagaacatggaaaagatcttcagttttctacttaacacgcttcaagaaaat
gtaaacaagtaccgacaagcgaagacagataattctcaggagtcaaaggcccaagcaaac
tgtcgagtcggagtcgcggcactgaatactctagcaggctacattgactgggtgtccatg
agtcatatcactgctgaaaactgtaagctcttagagatgctctgcctgcttctgaacgaa
caggaacttcagttgggagccgctgaatgtcttctcattgcagtcagcagaaaaggcaag
ttggaagaccggaagcccctgatggtcttgtttggggatgttgccatgcattatatactc
tctgctgcacagactgctgatggaggaggcttggtagaaaaacattatgtcttcctgaag
agactctgtcaggtgttgtgtgctctgggcaatcagctgtgtgcattactgggtgtggat
tctgatgtagaaacaccagcaaactttggaaaatacctggaatcttttctcgctttcaca
acccatccaagtcagtttctacgctcttcaactcaaatgacttggggggcccttttccgg
catgagatcctatcccgtgaccctttgctattagcaataataccaaaatatcttcgtgct
tctatgactaacttggtcaagatgggctttccttctaaaacagacagccctagctgtgaa
tactctcgatttgattttgatagtgatgaggacttcaatgctttcttcaactcctcccgg
gcccaacaaggagaggtaatgaggttagcatgtcgtttggatcctaagactagcttccag
atggctggggagtggctaaagtatcagctgtcaacttctgttgatactggatccatgaac
tctggaactggagaaggtgccctctgctccatcttctcatcttcattcgtgcagtgggaa
gccatgactttttttttggaaagtgtggtcaaccagatgtttcggacactagataaagaa
gcggttcctgttaatgacggaatagagctgttgcaaatggtcctgaactttgacaccaag
gatcctctcatcctgtcctgtgtcctcactaatgtctcagcactctttccatttgtcacc
tacagaccagagttcctgccccaagtcttctctaagctattttcatctgtcacttttgaa
accgttgaagaaagtaaggcccccagaacccgggcagtgaggaatgtgaggagacatgct
tgttcctccatcatcaagacatgtcgtgactacccccagctcgtactgcccaattttgac
atgctttataaccatgtgaagcaactcctctccaatgagttactcttgacacaaatggag
aagtgtgccctcatggaagccctggttctcattagcaaccaattcaagagctacgagcgt
cagaaggtgttcctagaggagctgatggcaccagtggccagcatctggctttctgaagac
atgcacagagtgctgtcagatgttgatgcttttattgcctatgtgggcgctgatcggaag
agctgtgacccaggcccggaggatccctgtggtctgaaccgcgcacgaatgagcttttgt
gtatatagcattctgggtgttgtgaaacgaacttgctggcccactgacctagaagaggcc
aaagctgggggattcgtggtgggttatacgcccagtggaaatccaatcttccgtaacccc
tgcacggaacagattctgaaacttcttgacaatttgcttgcccttataagaactcacaat
actttatatgcaccagaaatgctggccaagatgtcagagcctttcacaaaggctctggat
atgcttgaagcggagaaatctgcgattttaggcttacctcagcccctcttggaactgaac
gactctcctgtctacaaaacggtcttggaaagaatgcagcgtttcttctgcaccctctat
gaaaactgtttccacatcctcgggaaggcaggtccttccatgcagcaggacttctacagc
gtggagcaccttgctacgcagctcctcagctcagccttcgtcaacctgaacaacattccc
gactaccgactcagacccatgcttcgggtctttgtgaagcctctggtgctcttctgtccc
ccggagcactacggagccctggtgtctccaatccttggacctcttttcacctacctccac
atgaggctttcccagaaatggcaagtcatcaaccagcggagcctgctgtgtggggaagat
gacaccgcagatgacaacccagagtctcaagagatgttagaggaacagctggtgaggatg
ttaacccgagaagtcatggacctgatcacggtgtgctgtgtttcaaagaaaagtgctgac
cacggtactgctccccctacagatggagacgatgaagagatgatggccacagaggtggcc
ccctccaccatgacggagcttacagacctgggcagatgtctgatgaatcatgaggatgtt
tgtacggcgctattaattacagccttcaattcccttgcctggaaggataccctgtcctgc
cagaggacgaccacccagctctgctggcctctgctcaaacaagtgctgtcagggacactg
cttgcagatgccgtcacgtggcttttcaccagcgtgctgaagggcttacagacgcacggg
cagcacgatggctgcatggcttccctggtgcacctggccttccagatctacgaggcgctg
cgtcccaggtacctggagataagagctgtgatggagcagatcccggacatacagaaggac
tctctggaccagtttgactgcaagctgttgaacccctctctgcagaaagtggctgacaag
cgccgcaaggaccagttcaaacgcctcattgccggctgcatcgggaaacccttgggagag
cagttccgaaaagaagttcacattaagaatcttccctcacttttcaaaaaaacaaagcca
atgctggagacggaggtgctggacaacgaggagggtggcctggccaccatctttgaaccc
tga

DBGET integrated database retrieval system