KEGG   Ursus arctos horribilis: 113263946Help
Entry
113263946         CDS       T05909                                 

Gene name
CAMK2A
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit alpha isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
uah  Ursus arctos horribilis
Pathway
uah04012  ErbB signaling pathway
uah04020  Calcium signaling pathway
uah04024  cAMP signaling pathway
uah04066  HIF-1 signaling pathway
uah04114  Oocyte meiosis
uah04217  Necroptosis
uah04261  Adrenergic signaling in cardiomyocytes
uah04310  Wnt signaling pathway
uah04360  Axon guidance
uah04713  Circadian entrainment
uah04720  Long-term potentiation
uah04722  Neurotrophin signaling pathway
uah04725  Cholinergic synapse
uah04728  Dopaminergic synapse
uah04740  Olfactory transduction
uah04750  Inflammatory mediator regulation of TRP channels
uah04911  Insulin secretion
uah04912  GnRH signaling pathway
uah04916  Melanogenesis
uah04921  Oxytocin signaling pathway
uah04922  Glucagon signaling pathway
uah04925  Aldosterone synthesis and secretion
uah04934  Cushing syndrome
uah04971  Gastric acid secretion
uah05031  Amphetamine addiction
uah05152  Tuberculosis
uah05200  Pathways in cancer
uah05205  Proteoglycans in cancer
uah05214  Glioma
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    113263946 (CAMK2A)
   04310 Wnt signaling pathway
    113263946 (CAMK2A)
   04066 HIF-1 signaling pathway
    113263946 (CAMK2A)
   04020 Calcium signaling pathway
    113263946 (CAMK2A)
   04024 cAMP signaling pathway
    113263946 (CAMK2A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    113263946 (CAMK2A)
   04217 Necroptosis
    113263946 (CAMK2A)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    113263946 (CAMK2A)
   04922 Glucagon signaling pathway
    113263946 (CAMK2A)
   04912 GnRH signaling pathway
    113263946 (CAMK2A)
   04921 Oxytocin signaling pathway
    113263946 (CAMK2A)
   04916 Melanogenesis
    113263946 (CAMK2A)
   04925 Aldosterone synthesis and secretion
    113263946 (CAMK2A)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    113263946 (CAMK2A)
  09154 Digestive system
   04971 Gastric acid secretion
    113263946 (CAMK2A)
  09156 Nervous system
   04725 Cholinergic synapse
    113263946 (CAMK2A)
   04728 Dopaminergic synapse
    113263946 (CAMK2A)
   04720 Long-term potentiation
    113263946 (CAMK2A)
   04722 Neurotrophin signaling pathway
    113263946 (CAMK2A)
  09157 Sensory system
   04740 Olfactory transduction
    113263946 (CAMK2A)
   04750 Inflammatory mediator regulation of TRP channels
    113263946 (CAMK2A)
  09158 Development and regeneration
   04360 Axon guidance
    113263946 (CAMK2A)
  09159 Environmental adaptation
   04713 Circadian entrainment
    113263946 (CAMK2A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113263946 (CAMK2A)
   05205 Proteoglycans in cancer
    113263946 (CAMK2A)
  09162 Cancer: specific types
   05214 Glioma
    113263946 (CAMK2A)
  09165 Substance dependence
   05031 Amphetamine addiction
    113263946 (CAMK2A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    113263946 (CAMK2A)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113263946 (CAMK2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113263946 (CAMK2A)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     113263946 (CAMK2A)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   113263946 (CAMK2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr SnoaL_3 DUF4440 APH Pkinase_fungal Kdo SnoaL_2 SnoaL_4
Motif
Other DBs
NCBI-GeneID: 113263946
NCBI-ProteinID: XP_026366547
UniProt: A0A3Q7XTV1
Position
Unknown
AA seq 478 aa AA seqDB search
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRIAAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKNDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEA
ISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIH
LMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPQ
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggccaccatcacctgcacccgcttcacagaagagtaccagctcttcgaggaactggga
aagggagccttctcggtggtgcgccgttgcgtgaaggtgctggctggccaggagtatgct
gcaaagatcatcaacaccaagaagctctcagccagagaccatcagaagctggagcgcgaa
gcccgcatctgtcgcctgctgaagcaccccaacatcgtccggctccacgacagcatctcc
gaggagggacatcattacctgatcttcgacctggttaccggtggggagctgtttgaggac
atcgtggcccgggagtattacagtgaggccgatgccagtcactgtatccagcagatcctg
gaagccgtgctgcactgtcatcagatgggcgtggtgcaccgcgacctgaagccggagaat
ctgctgttggcctccaagctcaagggggccgcggtgaaactggcagacttcggcctggcc
atcgaggtggagggggagcagcaggcatggttcgggttcgcaggcacgccaggatacctc
tccccagaagtgctgcggaaggacccgtacgggaagcccgtggacctgtgggcctgtggg
gtcatcctctacatcctgctggttgggtaccccccattctgggacgaggaccagcaccgc
ctgtatcagcagatcaaagccggcgcctatgatttcccgtcaccggaatgggacaccgtc
accccggaagccaaggatctcatcaataagatgctgaccatcaacccgtccaagcgcatc
gcggctgccgaggccctcaagcacccctggatctcgcaccggtccactgtggcctcctgc
atgcacagacaggagaccgtggactgcctgaagaagttcaacgccaggagaaaactgaag
ggagccatcctcaccacgatgctggctaccaggaacttctctggagggaagagtggagga
aacaagaagaacgatggtgtgaaggaatcttcagagagtaccaacaccaccatcgaggac
gaagacaccaaagtgcggaaacaggagattattaaagtgacagagcagctgattgaagcc
ataagcaatggagattttgagtcctacacgaagatgtgtgaccccgggatgacggccttc
gaacctgaggccctggggaacctggtcgagggcctggacttccatcgattctattttgaa
aacctgtggtctcggaacagcaagcccgtgcacaccaccatcctgaacccccatatccac
ctgatgggcgacgagtcggcctgcatcgcctatatccgcatcacgcagtacctggatgcg
ggcggcatcccccgcacggcccagtcggaggagacccgcgtctggcaccgccgggatggc
aaatggcagatcgtccacttccacagatctggggcgccctccgtcctgccccagtaa

DBGET integrated database retrieval system