KEGG   Ursus arctos horribilis: 113265378Help
Entry
113265378         CDS       T05909                                 

Gene name
DHX8
Definition
(RefSeq) ATP-dependent RNA helicase DHX8
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
uah  Ursus arctos horribilis
Pathway
uah03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:uah00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    113265378 (DHX8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:uah03041]
    113265378 (DHX8)
Enzymes [BR:uah01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     113265378 (DHX8)
Spliceosome [BR:uah03041]
 Complex C
  Other components
   Step II factors
    113265378 (DHX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 S1 Helicase_C DEAD AAA_22 T2SSE AAA_19 Flavi_DEAD AAA_30 AAA_16 PhoH ABC_tran Sigma54_activ_2
Motif
Other DBs
NCBI-GeneID: 113265378
NCBI-ProteinID: XP_026368507
UniProt: A0A3Q7XYF9
Position
Unknown
AA seq 1218 aa AA seqDB search
MAVAVALAGAVTGTELGPAEELAKLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKN
TTFDTFKASLVKNGAEFTDSLISNLLRLIQTMRPPAKPSTSKDPVVKPKTGKEKLKELFP
VLCQPDNPSVRTMLDEDDVKVAVDVLKELEALMPSAAGQEKQRDAEHRDKTKKKKRSRSR
DRDRERDRDRDRDRDHKRRHRSRSRSRSRTRERNKGKSRYRSRSRSQSPPKDRKDRDKYG
ERTLDRWRDKHVDRPPPEEPAIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRR
EGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEET
SMRNPDRPTHLSLVSAPEVEDDSLERKRLTRISDPEKWEIKQMIAANVLSKEEFPDFDEE
TGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPIKIVKNPDGSLSQAAMMQSAL
AKERRELKQAQREAEMDSIPMGLNKHWVDPLPDAEGRQIAANMRGIGMMPNDIPEWKKHA
FGGNKASYGKKTQMSIIEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYL
AEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMT
DGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDA
VKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTG
QEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIA
ETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRL
YTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLY
TLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPK
DKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQM
LGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALF
NRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLY
NRYEEPNAWRISRAFRRR
NT seq 3657 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggctgtggccttggcgggagccgtaaccggcacagagctaggccccgcggag
gaactcgccaaactcgagtatctgtctttagtgtcgaaagtttgcaccgagctggacaat
cacctggggatcaacgacaaggatctggctgaatttgtgatcagtcttgctgagaaaaat
accacctttgatacttttaaggcatctctggtaaaaaatggtgccgaattcacggattcc
cttattagtaacttgttgcggctcatacagaccatgcggcctccagcaaagccttctact
agcaaagatccagttgttaaacccaaaactgggaaagaaaagctgaaggaactcttccca
gtcctttgccaaccggacaacccttctgttcggaccatgctggatgaggatgatgtgaaa
gtcgctgtggatgtcctaaaggaactggaggccttaatgcccagtgcagcgggccaggag
aagcagagagatgctgagcaccgggacaagacaaagaagaagaagcggagccggagccgc
gaccgggaccgagaacgtgaccgagaccgagaccgtgatagagaccacaagaggagacac
cggtcccgctcccggtcacgttccaggacccgggaaaggaataaagggaagtccaggtat
cggtccaggagcagaagtcagagtccccccaaagacaggaaggaccgggacaagtatggg
gaaaggactctggacagatggcgggataagcatgtggaccgcccacccccggaagagcct
gccatcggagacatttacaatggcaaagttaccagcatcatgcagtttggatgctttgtg
cagctggagggattaaggaagcggtgggaaggcctggtgcacatctctgagctccggcga
gaaggccgtgtggccaatgtggctgatgtggtgagcaaaggccagagggtgaaggtcaaa
gtactgtccttcactgggaccaagaccagtctgagcatgaaggatgtggatcaagagact
ggagaagatctaaaccccaaccggcgacgaaatctcgttggggagaccaatgaggagacc
tccatgaggaatccagacagacccactcacctctccctcgtcagcgcccctgaagtagag
gacgattcactggagcgcaagcgccttacccgcatctctgacccggagaagtgggagatc
aaacagatgattgctgccaatgtcctttccaaagaagagtttccggacttcgacgaagag
actggcattctccctaaagtggacgatgaagaagatgaagatcttgagatcgaactggtt
gaggaagagcctccgttcctgagaggccacaccaagcaaagcatggacatgagccctatt
aaaatcgtcaagaacccggatggttccctctcccaagcagcaatgatgcagagtgcctta
gccaaagaaaggcgggaactcaagcaggcccagcgggaagcggagatggattctattccc
atggggctcaacaaacactgggttgatcctctgcctgatgcggaaggcaggcagattgct
gccaatatgaggggtattgggatgatgcccaatgacatccctgagtggaagaagcatgcc
tttgggggcaacaaagcttcttacgggaaaaagacgcagatgtcaatcattgagcagaga
gagagcctgcccatctacaagctgaaggagcagctggtccaggctgtccatgacaaccaa
atcctgattgttattggagagacaggatctgggaagaccacgcagatcacccagtacctg
gcggaggcaggctacacgtcccggggcaagataggatgtacccagcccagaagagtagca
gccatgtccgtggccaaaagagtgtcggaggagtttggttgttgcttgggccaagaggtg
ggctacaccattcgctttgaggactgcaccagcccggagacagtgatcaagtacatgaca
gacgggatgttgctccgagagtgcctgattgaccccgacctcacacagtacgcgatcatc
atgttggacgaggcgcacgagagaaccattcacaccgacgtgctctttggattgctgaag
aagacggttcagaagcggcaggacatgaagctgatcgtcacctccgccacgctggacgca
gtgaagttttcgcagtacttctacgaagcgcccatcttcaccatcccaggtcggacatac
ccggtggaaatactgtacacgaaggaacccgagacagattatctggacgccagcttgatc
accgtcatgcagatccatttaacagaaccgccaggtgatatcctggtcttcctgactggt
caggaggagatcgataccgcttgcgagatcctctatgaaagaatgaaatccctgggaccg
gatgttccagagctgatcatcctgccggtatactctgctcttcccagtgagatgcagacc
cgaatcttcgacccggctccgcctggcagcaggaaggtcgtgattgccaccaacatcgca
gagacctcgctgactattgatggcatctactatgtggtggaccctgggtttgtgaagcaa
aaagtttacaattccaagactggcatcgatcagctcgtggtcactccgatttctcaggct
caggcaaaacaacgagctggcagagccggcagaacaggcccaggaaagtgttacaggctg
tacaccgaacgtgcctaccgagatgaaatgctgaccaccaacgtgccggaaatccagagg
accaacctagcgagcacagtgctctcgctcaaggccatgggcatcaatgacctgctgtcc
tttgacttcatggacgcccctccaatggaaaccttgatcacggccatggagcagctgtac
acgctgggggccttggacgacgagggcctgctcactcgcctgggccgcaggatggcagaa
ttccctctggagcccatgctgtgcaaaatgctgatcatgtccgtgcatctgggctgcagc
gaggagatgctaaccatcgtgtccatgctgtcggtgcagaacgtcttctacaggcccaag
gataaacaagccctcgcagaccagaagaaagccaagttccaccagaccgaaggggaccac
ctcaccctgctggccgtgtacaactcctggaagaacaacaagttctccaacccgtggtgc
tacgagaactttatccaggctcgctctctgcgccgggcccaggatattcgcaagcagatg
ttgggcataatggacaggcacaagctggatgtggtctcctgtggcaagtccacggtgcga
gtgcagaaggccatctgcagtggattcttccggaacgctgccaagaaagacccgcaggag
ggctaccggacgctgatcgaccagcaggtggtctacatccacccttccagcgctctcttc
aacagacagcccgaatgggtggtgtaccacgagctggtgctgaccacgaaggagtacatg
cgtgaggtcaccactatcgaccccaggtggcttgtagagttcgccccggccttcttcaag
gtctccgacccgaccaagctgagcaagcagaagaagcagcagcgtcttgaacccttgtac
aaccgctacgaggagcccaacgcgtggagaatatcccgggccttccggcggcgctga

DBGET integrated database retrieval system