KEGG   Ursus arctos horribilis: 113265436Help
Entry
113265436         CDS       T05909                                 

Gene name
CNP
Definition
(RefSeq) 2',3'-cyclic-nucleotide 3'-phosphodiesterase isoform X1
  KO
K01121  2',3'-cyclic-nucleotide 3'-phosphodiesterase [EC:3.1.4.37]
Organism
uah  Ursus arctos horribilis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113265436 (CNP)
Enzymes [BR:uah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.37  2',3'-cyclic-nucleotide 3'-phosphodiesterase
     113265436 (CNP)
Exosome [BR:uah04147]
 Exosomal proteins
  Exosomal proteins of oligodendrocytes
   113265436 (CNP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNPase AAA_33 AAA_22 Zeta_toxin AAA_16 AAA KTI12 AAA_30 AAA_17 AAA_18 NACHT ABC_tran AAA_5 CPT Viral_helicase1 NB-ARC TsaE AAA_14 MMR_HSR1 AAA_29 AAA_19 DUF4823
Motif
Other DBs
NCBI-GeneID: 113265436
NCBI-ProteinID: XP_026368611
UniProt: A0A3Q7W654
Position
Unknown
AA seq 420 aa AA seqDB search
MNRSFSRKSHTFLPKIFFRKMSSSGAKDKPELQFPFLQDEETVAALQECKTLFLLRGLPG
SGKSTLARAIVDRYRDGTKMVSADAYKITPGGRGDFSEEYKRLDDELAAYCRRDVRVLVL
DDTNHERERLEQLFDLADQYQYQVVLVEPKTAWRLDCAQLKEKNQWQLSADELKKLKPGL
EKDFLPLYFGWFLTKKSSESLRKAGQAFLEELGNHKAFKKELRHFVSGDEPREKIELVTY
FGKRPPGVLHCTTKFCDYGKAAGADEYAQQDVVKKSYCKAFTLTITALFVTPKTTGARVQ
LSEQELPLWPNDVDKLSPSDSLPRGSRAHITLGCAGDVEPVQTGIDLLEIVRQEKGGSRG
EEVGELHRGKLYSLGNGRWLLSLAKKLEVRAIFTGYYGKGKPVPAHGSRKGGALQSCTII
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaagcttctcccgaaagagccacacgttcctgcccaagatcttcttccgcaag
atgtcgtcgtcaggggccaaggacaagcctgagctgcagtttcctttcctgcaggacgag
gagaccgtggccgcgctgcaggagtgcaagacgctcttcctcctgcgcggcctgccgggc
agcggcaagtccaccctggcgcgcgccatcgtggacaggtaccgcgacggcacgaagatg
gtgtcggccgacgcctacaagatcacccccgggggccgcggagacttctcggaggagtac
aagcggctggacgacgagctggccgcctactgccggcgggacgtgcgcgtcctggtgctg
gacgacaccaaccacgagcgggagcggctggagcagctcttcgacctggccgaccagtac
cagtaccaggtggtgctggtggagcccaagacggcgtggcggctggactgcgcccagctc
aaggagaagaaccagtggcagctgtcggccgacgagctcaagaagctgaagccggggctg
gagaaggacttcctgccgctctacttcggctggttcctgaccaagaagagctccgagagc
ctccgcaaagccggccaggccttcctggaggagctgggcaaccacaaggccttcaagaag
gagctgcgacactttgtctctggggatgagcccagggagaagatcgaactggtcacctac
tttgggaagagacccccaggcgtgctgcactgcacaaccaagttctgtgactacgggaag
gccgcgggggcagacgagtacgcccagcaggatgtggtgaagaagtcttactgcaaggcc
ttcacgctgaccatcactgccctcttcgtgacgcccaagactacgggagcgcgggtgcag
ctgagcgagcaggagctgccgttgtggcccaatgacgtggacaagctgtccccctccgac
agcctgccccggggcagccgcgcccacatcaccctcggctgcgcgggtgacgtggagccc
gtgcagacaggcattgacctcctggagattgtgcggcaggagaaggggggcagccgaggc
gaggaggtgggtgagctacaccggggcaaactctactccttgggcaacgggcgctggctg
ctgagcctggccaagaagctggaggtcagggccatcttcacgggatactacgggaagggc
aaacctgtgcccgcgcacggcagccgcaaggggggcgccttacagtcctgcaccatcatc
tga

DBGET integrated database retrieval system