KEGG   Ursus arctos horribilis: 113266572
Entry
113266572         CDS       T05909                                 

Gene name
ADAMTS13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
uah  Ursus arctos horribilis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:uah01002]
    113266572 (ADAMTS13)
Enzymes [BR:uah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     113266572 (ADAMTS13)
Peptidases and inhibitors [BR:uah01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   113266572 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS ADAM_CR_2 TSP_1 Reprolysin Reprolysin_4 Reprolysin_3 TSP1_spondin ADAM_spacer1 Reprolysin_5 Peptidase_M10 Reprolysin_2
Other DBs
NCBI-GeneID: 113266572
NCBI-ProteinID: XP_026370073
UniProt: A0A3Q7X6X9
Position
Unknown
AA seq 1562 aa
MRQPHPWGRGVGAILTSAFFLLGCWGLSDFQQEFLQALAPEEVTSYFGPEATLKVPPFDV
APLSCICEDGPGGPPCRAPSCSLHAWGQLFTVSFPPEQSLLTASFTSEHVLNASLRLLRW
PPHLCFSGGRPLLPLGAVARVTYCSGHLEGDILVGADRFYVQPVRRQHQELVPPWVRAQP
HLIHRPVPKAPVAPEAPEVIREPSLSALPPPSAGRPPHSRVRRWAAGSVLHLELLVAVGP
DVYQAHQEDTERYVLTNLNMGSELLRDPSLGAQFRVHLVKLVILTQPEDAPNITANITAS
LLSVCEWSRTVNPEDDMDPGHADLVLYVTRFDLELPDGNRKVRGVTQLGGACSSSWSCLI
TEDTGFDLGVTIAHEIGHSLGVEHDGAPGSGCEPSGHVMASQDAAPAGGDLSWSACSRRQ
LLHLLSTGRAHCMRDPPEQQAGAAGHPPQAQPGLLYGADEQCRVAFGARAVACTFAREHL
DMCQALSCHTDPLDQRRCSRLLVPLLDGTECGVQKWCSKGHCRSLAELSPVGVVHGHWSS
WGAPSPCSRSCGGGVVTRRRQCNNPRPAFGGRACVGADLQAEMCNTQACEKTQLEFMSEQ
CSQTDRKPLHLSPGNTSFYRWGSAEQYSQGDALCRHMCRAIGETFIVRRGDSFLDGTRCV
PRGRREDGTLSLCVLGSCRTFGCDGRMDSPQVRDVCQVCGGDNSTCSLRNGSFTAGRARE
YVTFLTVTRNLTSVHITNRRPLFTHLAVRIRGRYVVAGNSSISPSTTYPSLLEDSRVEYR
VALTEDRLPRLEEIRIRGPTQEDMEIQVYRRYGEEYGDLARPDITFTYFQPQQPQAWAWA
AVRGSCSVSCGAGLRWVTYSCLDQARNEWVEAARCEGSQQPAAWPESCAPQPCPPHWAAG
DFGACSASCGGGLRERVVRCVEAQGSVLRTLPPDRCRALAPQPTVVEACNSQPCPERREG
SDACSSACGADPALRNRTCVRGAEGPEALATTGPCSTDEKLPALEPCVAMACPSGPGHPD
PRSLEEEATSPPGSARLGAHAAHVWTPLAGPCSASCGRGLMELRFACMDSALGTSVREEL
CDLESKPGSRQEACQAAPCPAWWRYELTACRASCGRGFVQGMLYCARAHEQDEDEGILPD
ARCQGLPRPEQQEACSPEPCPPRWKIVSLGPCSASCGLGTATRSVACVRLSQGQDTEVDG
AACAALVRPQASIPCIIAECTHRWHVSAWMQCSVSCGDGIQRRHYACLGPQAQAPVPAGF
CQHLPKPATVRGCWAGPCVGQGTPSPAPREEATAPDEAAAGASPEWPQPRAHLLTPAPLV
QGLLPGPQESPAESSTCGQQHLEPTGTIDMRGPGQADCAVAIGRPLGEVVTLHVLESSLS
CSAGDMLLLWDRLTWRKTCGKLTGMTFSSKANTLVVRQRRVQPEGGLVLRYGSQPAPGTP
HRDCDMQLFGPWGEIVSPSMSPNGSNSGGCRIFINVAPQARIAIHALATDMGTGTGASYI
SIRDIHSLKTMTFRGQQALYWESEGSQAEMEFSQGFLEAHASLRGQYWTLQSRVQEPGWA
VP
NT seq 4689 nt   +upstreamnt  +downstreamnt
atgaggcagcctcacccttgggggagaggtgtgggggcaattctcacttcggccttcttt
ctcctgggctgctggggtctctccgatttccagcaggaatttcttcaggctttggcacca
gaggaagtgacttcttattttggccctgaagctactttaaaagtgcctccattcgatgtg
gcccctctcagctgcatctgtgaagatgggcccggggggcctccctgcagggccccaagc
tgctccctgcacgcctggggccagctcttcaccgtctccttcccgccggagcagagcctc
cttacagcctccttcaccagcgagcacgtgctgaacgcctccctgcggctactgagatgg
ccgccccatctctgcttctcgggaggccgccccctgctgcccctgggtgccgtggccaga
gtcacttactgctcgggccacttggagggtgacatccttgtcggtgcggaccggttttac
gtccagccagtgaggagacagcaccaggagctggtgcctccctgggttcgtgcccagccc
cacctgatccacaggcctgtccccaaggcccccgtggcccccgaggccccagaagtcatc
cgagaaccttcgctgtcagccctgcctcctccctcagcaggccgtcctcctcattctcga
gtccggagatgggctgccgggagcgtcctgcacttggagctgctggtggccgtgggcccc
gacgtctaccaggctcaccaggaggacactgagcgctacgttctcactaacctcaacatg
gggtcagagctgctgagggacccatccctgggggctcagttccgagtacatttggtgaag
ttggtcatcctgacccagcccgaggatgccccgaatatcacagccaacatcacggcgtca
ctgctgagcgtctgcgagtggagcaggacggtcaaccctgaggacgacatggatcccggg
catgccgacctggtcctctacgtcaccaggtttgacctggagttacctgatggtaaccgg
aaggttcggggggtcacccagctggggggtgcttgctcgtcctcctggagctgcctcatc
accgaggatactggctttgacctgggggtcaccatcgcccatgagattgggcacagcttg
ggcgtggagcacgacggtgcgccgggcagcggctgcgagcccagcggccacgtgatggcg
tcccaggacgcggcgcccgccggcggcgacctctcgtggtccgcctgcagccgccggcag
ctgctgcacctgctgagcacaggacgggcgcactgcatgcgggacccgccagagcagcag
gccggagccgcggggcaccctccccaggcgcagcccggcctcctctacggcgcggacgag
cagtgccgcgttgccttcggcgccagggcggtggcctgcaccttcgccagggaacacctc
gacatgtgccaggctctgtcctgccacactgaccccctggaccaacgccgctgtagccgc
ctcctcgttcctctcctggatgggacagagtgcggcgtgcagaagtggtgctccaagggt
cactgccgctccctggcagagctgagccccgtgggggtggtgcacgggcactggtctagc
tggggtgcccccagtccttgctcccgctcctgcggagggggtgtggtcacccggaggcgg
cagtgcaacaaccccaggcctgccttcggagggcgtgcgtgtgtgggtgctgacctccag
gccgagatgtgcaacacccaggcctgtgagaagacccagctggagttcatgtccgagcag
tgctcccagacggacaggaaaccgctgcacctctccccgggcaacacctccttctaccgc
tggggctccgctgagcagtatagtcaaggggacgctctgtgcagacacatgtgccgggcc
attggcgagaccttcattgtgaggcgtggggacagtttcctggacgggacccggtgtgtg
ccacgtggtcggcgggaggacgggaccctgagcctgtgcgtgttgggcagctgccggacg
ttcggctgtgatggcaggatggactccccacaggtgcgtgacgtgtgtcaggtgtgcgga
ggggacaacagcacgtgcagcctgcggaacggctctttcacggccggaagggccagagag
tatgtcacgttcctgaccgtgacccgaaacctgaccagcgtacacatcaccaaccggagg
cctctctttacacacctggcggtgcggatccgagggcgctacgtcgtggctgggaattcc
agcatctcccccagcaccacctacccctccctcctggaggacagccgtgtggagtacaga
gtggccctcaccgaggaccggctgcctcgcctggaggagatccgaatccggggacctacc
caggaagacatggagatccaggtttacaggcgttatggggaggagtatggtgacctcgcg
cgcccagacatcaccttcacctactttcagcctcagcagccgcaggcctgggcatgggcc
gctgtgcgggggtcctgctcggtgagctgtggggcagggctgcgctgggtgacctacagc
tgtctagaccaggccaggaacgagtgggtggaggctgcccggtgcgaagggagccagcag
ccggcagcgtggccagagtcctgcgccccccagccctgccccccacactgggcagccgga
gacttcggtgcgtgcagtgcgtcctgcgggggaggcctgcgggagagggtggtgcgttgc
gtggaggcccagggcagcgtcctgaggaccttgccccctgaccggtgcagagcgctggcc
ccacagccgacggtggtggaagcttgcaactcccagccttgcccggagaggcgggagggg
tcagacgcatgctcgtcagcgtgtggagcagacccggctttgcggaataggacatgtgtg
cgcggggcagagggcccggaggccctggccacgactgggccctgctctacagatgagaag
ctgcctgccctcgagccctgtgtggccatggcctgtccttcaggaccgggccacccagac
ccccggtctctggaggaggaggccacatccccgccgggcagtgccaggctgggggctcac
gccgcacacgtgtggacgcccctggcggggccgtgctctgcctcctgtggtcgaggcctg
atggagctgcgctttgcgtgcatggactctgccctggggacctctgtccgggaagagcta
tgtgacctggaaagcaagcctgggagccggcaggaggcctgccaggctgccccttgcccg
gcttggtggcggtacgagctgacagcgtgccgcgcgagctgcgggcgagggtttgtgcag
gggatgctgtattgtgcacgggcccacgagcaggacgaggatgaggggatcctgccagat
gcccggtgccaggggctgcctcgcccagagcagcaggaggcctgcagcccagagccctgc
ccgcccaggtggaaaatcgtgtcccttggcccatgctctgccagctgtggccttggtacc
gccacacgctccgtggcctgtgtgcggctcagccaaggccaggacacggaggtggatggg
gcggcctgtgcggctctggtacggcctcaggccagcatcccctgcatcatcgccgaatgc
acccaccgctggcatgtcagcgcctggatgcagtgctctgtctcctgcggagatggcatc
cagcgccggcattacgcctgccttggaccccaggcccaggcacctgtgccagctggcttc
tgccagcacttgcccaagccagccacggtgcggggctgctgggccgggccctgtgtcggg
caggggactcccagtccggcgccccgcgaggaagccactgctccagacgaggctgctgcc
ggtgcttctccggaatggcctcagccccgggcccacctcctcaccccagctcccctggtt
caggggcttctgcctgggccccaggaaagcccagctgagtccagcacctgtggccagcag
caccttgagccgacaggaaccattgacatgcgaggcccagggcaggccgactgtgcggtg
gccattgggcggcccctgggtgaggtggtgaccctgcacgtcctcgagagctccctcagc
tgcagtgctggggacatgttgctgctttgggacaggctcacatggaggaagacgtgcggg
aagctgaccggcatgactttcagctccaaagccaacacgctggtggtgaggcaacgccgc
gtgcagcctgaaggcgggcttgtgctgcggtatgggagccagcctgccccgggcaccccc
cacagagactgtgacatgcagctctttggaccctggggtgaaatcgtgagcccctcgatg
agtcctaatgggagcaactcggggggctgccgcatcttcattaacgtggccccacaggcc
cggattgccatccatgccctggccactgacatgggcacgggaactggtgccagctacatc
tcaatccgggacatccacagcctgaagacgatgacattccgtgggcagcaggcactctac
tgggagtcagagggaagccaggctgagatggagtttagccagggcttcctggaggcgcat
gccagcctgcggggccagtactggaccctccaatctagagtgcaggagccgggctgggcc
gtgccctag

DBGET integrated database retrieval system