KEGG   Ursus arctos horribilis: 113267389Help
Entry
113267389         CDS       T05909                                 

Gene name
GALC
Definition
(RefSeq) galactocerebrosidase isoform X1
  KO
K01202  galactosylceramidase [EC:3.2.1.46]
Organism
uah  Ursus arctos horribilis
Pathway
uah00600  Sphingolipid metabolism
uah01100  Metabolic pathways
uah04142  Lysosome
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    113267389 (GALC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    113267389 (GALC)
Enzymes [BR:uah01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     113267389 (GALC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_59 Glyco_hydro_59M Glyco_hydro_30
Motif
Other DBs
NCBI-GeneID: 113267389
NCBI-ProteinID: XP_026371287
UniProt: A0A3Q7Y3J2
Position
Unknown
AA seq 685 aa AA seqDB search
MAERLLQASRQRRGKAMTAAAGSAGRAAVPLLLCVLLVPGGAYVLDDSDGLGREFDGIGA
ISGGGATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYA
LDENYFRGYEWWLMKEAKRRNPNITLMGLPWSFPGWLGKHFNWPYVNLQLTAYYVMTWIV
GAKHYHDLDIDYIGIWNERSFDINYIKVLRRMLNYQGLDRVKIIASDNLWEPISASMLLD
SELMEVIDVIGAHYPGTHTVKDAKLTNKKLWSSEDFSTLNSDVGAGCLGRILNQNYINGY
MTATIAWNLVASYYEQLPYGRCGLMTAQEPWSGHYVVESPIWVSAHTTQFTQPGWYYLKT
VGHLEKGGSYVALTDGLGNLTIIVETMSHKYSTCIRPFLPYYNVSHQFATFVLKGSFSEI
PELQVWYTKLGKPSTRFLFKQLDSLWLLDSGGTFTLELREDELFTLTTLTTGGKGSYPLP
PKSQPFPRIYKDDFDVDYPFFSEAPNFADQTGVFEYFTNIEDPGEHRFTLRQVLNQRPIT
WAADASNTISIIGDYKWSNLTVTCDVYIETPEKGGVFIAGRVNKGGILIRSARGVFFWIF
ANGTYRVTGDLAGWIIYALGHVDVTAKKWYTLTLIIKGRLCSGMLNGTYVWTNVPVSFPK
NGWAAIGTHAFEFAQFDNFRVEAAS
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcgcctactccaggcttcccggcaacgccgagggaaagccatgacggccgcc
gcgggttcggcgggccgcgccgcggtgcccctactactgtgcgtgctgctggtgcccggc
ggcgcgtacgtgctggacgactccgacgggctgggccgggagttcgatggcatcggcgcg
atcagcggcggcggggcaacctcccgacttctagtaaattatccagagccctatcgttct
caaatattggattatctctttaagccaaacttcggtgcctctttgcatattctgaaagtc
gaaataggtggtgatgggcagacaacagatggtactgaaccctcccacatgcactatgca
ttagatgagaattatttccgaggatatgagtggtggttaatgaaggaagctaagaggcgg
aaccctaatattacactcatggggttgccgtggtcgttccctggatggctgggaaaacat
ttcaactggccttatgtgaatcttcagctgactgcctactatgtcatgacctggattgtg
ggcgccaagcattatcatgatttggatattgattatattgggatttggaacgagaggtca
tttgacatcaattatatcaaggtgttaagaagaatgttgaactatcaaggtctcgatcga
gtgaaaatcatagcgagtgacaatctctgggagccgatttctgcttctatgttgcttgac
tctgagctcatggaggtgattgatgttataggagctcattatcctgggacccatacagta
aaggatgcgaagttgactaacaagaagctttggtcttctgaagattttagcactttaaac
agtgatgtgggtgcaggctgcttgggccgcatattgaatcagaattatatcaatggctac
atgactgccacaattgcttggaacttggtggccagttactatgaacagttgccctatgga
cggtgtggattaatgactgctcaggagccatggagcgggcattatgtagtagagtctcct
atctgggtatcagctcataccactcagtttactcaaccaggttggtattacctgaagaca
gttggtcacttagagaaaggaggaagctacgtggccctgactgatggcctaggtaacctc
accatcatcgttgaaactatgagccataaatattctacatgtatacggccgtttctgcct
tactacaatgtgtcacatcagtttgctacctttgttcttaaaggttcttttagtgaaata
ccagagctacaggtgtggtatacgaagcttggaaaaccatctacgagatttctttttaaa
caactggattctctatggctcctcgacagcgggggcactttcaccctggagctgcgggag
gacgagctcttcacgctcaccactctcaccaccgggggcaagggcagctacccgctgcct
ccgaagtcccagcccttcccacggatttataaagacgatttcgatgttgattacccgttt
tttagtgaagctccaaatttcgctgatcagactggcgtctttgaatactttacgaatatt
gaagaccctggagagcatcgcttcacacttcgccaagttctcaatcagcggcccattact
tgggctgctgatgcatccaacaccatcagtattataggagattacaaatggtccaatctg
actgtaacgtgcgatgtttacatagagactcctgagaagggaggtgtgttcattgctgga
agagtaaacaaaggtggcatcttgattagaagcgccagaggagttttcttctggattttc
gcaaatggaacctacagagttacaggtgatctagctggttggatcatatatgctttagga
catgttgatgttacagcaaagaaatggtatacgctcacattaattattaagggccggctc
tgctcgggcatgctcaacggcacctacgtctggacgaacgtccccgtgagtttcccgaag
aacggctgggccgccattgggacgcacgcctttgagtttgcgcagttcgacaactttcgt
gtggaagccgccagctga

DBGET integrated database retrieval system