KEGG   Ursus arctos horribilis: 113268443
Entry
113268443         CDS       T05909                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
uah  Ursus arctos horribilis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:uah03021]
    113268443 (AFF3)
Transcription machinery [BR:uah03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     113268443 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 113268443
NCBI-ProteinID: XP_026372720
UniProt: A0A3Q7X5U8
Position
Unknown
AA seq 1259 aa
MASAFLLAGYIVSPSCGVYISYRGEDILNQRNDSLVVEFQSSASRCRSVYEPDRNVLRRK
ERERRNQETQQDDGTFNSSYSLFSEPYKTNKGDELSNRIQNTLGNYDEMKDFLTDRSNQS
HLVGVPKPGVPQAPVNKIDEHFVADSRAQTQPPSVCSTASSTPAAVPVQQSKRGSMGWPK
AGHPPSDGQQRATQQGSLRTLLGDGVGRQQPRAKQVCNVEVGLQTQERPPAMAAKHSSSG
HCVQNFPPSLASKPSLVQQKPTAYVRPMDGQDQAPDESPKLKSSTETSVHCTSYRGVPAT
KPESARAKAKLSKFSIPKQGEESRSGDTNSCVEEIIREMTWLPPLSAVPAPGKVEPSKFP
FPNKDSQLVSSGHNNPKKGDAEPESPDNGTSNTSMLEDDLKLSSDEEENEQQAAQRTALH
ALSDSAVVQQANCRASVPSSKGSSSGSSSSGSSSSSDSESSSGSDSETESSSSESEGSKP
PHYSSPEAEPASSNKWQLDKWLNKVNPHKPPLLIQNESHGPESNQYYTPAKEEVQDCGKL
PDVCQTSLREKDIKSACKEEQRPRTANKAPGSKGVKQKSPPAAVAVAVTTAAQPPAAPTA
PADSAPAPARRSAGKKPTRRTERTSAGDSANCHRPEEPAAGDALGASVVIPPEPTKTRPC
GNSRTSHRKELRSSVTCEKRRTRGLSRIVPKSKEFIETESSSSSSSSDSDLESEQEEYPL
SKAQAAAAATAVSSGSDQRLKEAASSISSGGGPRAPVGSINARTTSDIAKELEEQFYTLV
PFGRNELLSPLKDSDEVRSLWVKIDLTLLSRIPEHLPQEPGVLNAPAAKDAESTQPSHPS
DTPAEKALPKSKRKRKCDNEDDYREVKKAQGEKESSSRLTASANNTLSANHCSMNINSLA
IPINKNEKMLRSPISPLSDASKHKYSSEDLTSSSRSNGSGLFTSASSNKKHKTENQLQSH
AGDLTKATHNNSENVLHKSRPQTEPWSPGANGHRDCKRQKLVFDDMPRSADYFMQEAKRM
KHKADAMVEKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAMRLKT
HSGPNATPEDKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKNSSKAAQAPSPW
GASGKSTGTPSPMSPNPSPTSSVGSQGSLSNASALSPSTIVSIPQRIHQMAANHVSITNS
ILHSYDYWEMADNLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQGLHWLRNSTHLS
NT seq 3780 nt   +upstreamnt  +downstreamnt
atggctagtgcatttctattagcaggctacattgtttccccttcttgtggtgtctacatt
tcttacaggggtgaagacatcttaaaccagaggaatgactctctagttgtggaatttcag
tcgtcagccagcagatgcaggagtgtctatgaaccagatagaaatgtgttacggaggaaa
gaacgagaaagaagaaatcaggaaactcagcaggatgatggcacattcaattcaagttac
tccctcttcagcgaaccctacaagacgaacaagggggatgagctctccaaccggatccag
aatactttaggcaattatgatgaaatgaaagactttttaactgatagatctaatcagagt
catctcgttggtgttcccaaacccggggttcctcaggctcctgtgaacaagatcgatgaa
cattttgttgcggattcaagagcccagactcagccgccatctgtctgtagcactgcgtct
tccacaccagcagctgtccccgtgcagcagagtaagcggggcagcatgggctggccgaag
gctgggcacccgccatcagatggccaacagagagcaacacaacaaggctctctcaggacc
ttgcttggagatggtgtgggcagacagcagccacgagccaaacaagtgtgcaatgtagag
gtgggtcttcagacccaggaaaggccccctgctatggcagccaagcacagcagcagtgga
cactgtgttcagaactttcctccgtccctggcttcaaaacccagcctggtccagcagaaa
ccaactgcatacgtgcggccgatggacggccaagatcaggctcctgatgagtctccaaag
cttaagtcgtccacagaaaccagtgtgcactgcacgtcctacaggggagtcccggccacc
aagccggagtccgccagagccaaggccaagctttccaagttcagcatccccaaacaagga
gaggagagtagatctggagacacaaacagctgtgttgaagaaataattcgggagatgacc
tggctcccaccactttctgctgtcccagcacccggcaaagtggaaccaagcaaatttcca
tttccaaataaggactctcagcttgtttcctctggacacaataatccaaagaaaggtgat
gctgagccagagagtccagacaatggcacatcgaatacatcaatgctagaagatgacctt
aagctaagtagtgatgaagaggagaatgagcagcaggcagcccagagaactgctctccac
gctctgtctgacagcgccgtggtccagcaggccaactgcagagcctccgtgccttccagc
aagggcagcagcagcggcagcagcagcagcggcagcagctcgtccagtgactcagagagc
agctctggatctgactcggagactgagagcagttccagcgagagtgagggcagcaagcct
ccccactactccagccccgaggctgaacccgcgtcctctaacaagtggcagctggataag
tggctaaacaaagttaatccccacaagccgcctcttctgatccaaaatgaaagccacggg
ccagagagcaatcaatactacactccagcgaaagaggaagtgcaggactgtgggaaactt
cccgacgtttgccaaaccagcctgagagagaaggacatcaagagcgcctgcaaggaggag
cagaggccaaggacagcgaacaaggccccggggagtaaaggagtgaagcagaagtccccg
cccgcggctgtggccgtggctgtgaccacagctgcccagccgcccgccgcgcccaccgcg
cccgccgatagcgcgccggcgcccgcccggaggtcagcaggaaagaagcccaccaggcgc
accgagaggacctccgccggcgacagcgccaactgccaccggcctgaggagcccgcggct
ggagacgcgctgggggcgagcgtggtgatccctccggagcccaccaaaaccaggccctgc
ggcaacagcagaacgagccaccgcaaggaactgcgctcctcggtgacctgcgagaagcgc
cgcacgcgggggctgagcaggatcgtccccaaatccaaggagttcatagagacagagtcg
tcatcttcttcctcctcctcggactcggacctggaatcagagcaagaggagtatcctctg
tccaaagcgcaggccgccgccgctgccactgcggtctcctcggggagtgaccagaggctg
aaggaggcggccagcagcattagcagtggcggcgggccccgggccccggtgggctccatc
aacgccaggaccaccagtgacattgccaaggagctggaggagcagttctacacgctggtc
cctttcggccgcaatgaacttctctcccccttgaaggacagtgatgaggtcaggtctctc
tgggtcaaaattgacctgaccctcctgtccaggatcccagaacacctgccccaggagccc
ggggtcttgaatgcccctgcagccaaggacgctgagagcacgcagccaagccatccatct
gacactcctgctgaaaaggctttgccaaaatccaagaggaaacgcaagtgtgacaacgaa
gatgactacagggaggtcaagaaggcccagggagagaaagagagctcttcacgactgacc
gcctctgccaataatactttatctgcaaaccactgcagcatgaacatcaacagcttggca
ataccaataaataaaaatgaaaaaatgctccggtcacccatctcacccctctcggatgca
tctaaacacaaatactccagcgaggacttaacttcttccagcagatcaaatggcagtggc
ttgttcacttctgcctcctccaacaaaaagcataagactgagaaccagctacagtctcat
gccggagacctcacgaaagccactcacaacaattccgaaaacgttctccacaagtcacgg
ccacagacagagccatggtctccaggtgccaacggccacagggactgcaagaggcagaaa
cttgtcttcgatgatatgccacgcagtgcagattattttatgcaagaagctaaacggatg
aagcataaagcagatgcaatggtggaaaagtttggaaaggctttgaactacgctgaagca
gctttgtcatttattgagtgtggaaacgcaatggaacaaggcccaatggagtctaaatct
ccttatacaatgtattcggaaacagtagagctcatcaggtatgctatgagactaaaaaca
cattcaggccccaatgccaccccagaggacaaacaactggctgcattatgttaccgctgc
ctggctctcctgtactggcggatgtttcgactcaaaagggaccacgctgtgaagtattca
aaagcacttatcgactatttcaagaattcatctaaagctgcccaagccccatctccatgg
ggagccagtggaaagagcactggaactccatcccctatgtctcccaacccctccccgacc
agctccgtgggatctcaggggagcctctccaatgccagcgccctgtccccttcaaccatc
gtcagcatcccacagcgcatccaccagatggcagccaatcacgtcagcatcaccaacagc
attctccatagctatgactactgggagatggcggacaacctggccaaggaaaacagagaa
ttcttcaacgacttggatttgctcatggggcctgtcaccctgcacagcagcatggaacat
ctggtccagtactcccagcagggcctgcactggctgcggaacagcacccacctgtcatag

DBGET integrated database retrieval system