KEGG   Ustilago maydis: UMAG_01197Help
Entry
UMAG_01197        CDS       T01021                                 

Definition
(RefSeq) hypothetical protein
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
uma  Ustilago maydis
Pathway
uma00780  Biotin metabolism
uma01100  Metabolic pathways
Module
uma_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:uma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    UMAG_01197
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:uma01007]
    UMAG_01197
Enzymes [BR:uma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     UMAG_01197
Amino acid related enzymes [BR:uma01007]
 Aminotransferase (transaminase)
  Class II
   UMAG_01197
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 23562292
NCBI-ProteinID: XP_011387136
UniProt: A0A0D1CDZ4
Position
2
AA seq 496 aa AA seqDB search
MLDDELQSALDRRAANGTLRQLTVYPTATSSSSFSSSSSSSSSSFDLASSKRPLVDFSSN
DYLSLATSSRVRADFASMVTSNPSLSSQLGSAGSRLLDGNSSIHEATELELTEHFASSSA
GLLFNSGYEANVSLLSTLPQPRDVVIYDELVHASVHDGLRRSRVSTHLRIPFRHNSVEHL
EEILERLIQDGTLTAATNSNASGARNIWLAVESVYSMDGDVCPLQSLLDAMSRYVDDKRI
CAIVDEAHSTALYGVRGRGLINALGLQADRRIAARLMTFGKAWGASGAIVLCSKVARHYL
INYARPFIFSTALGYPQLTSILASFNSIKDGTAQRAACRTFANSRRLVDGFEAVIRAQLS
DATRSIALPPHLRPETQLETQPKQKPDQGEEHNHDFVSWSMQQPSPIIPLLTADARELAA
HLRANGLLARPICYPTVPKGEDRVRICVHADNTAEDIDRLIECVRMWTEEAQGQRIGNVV
NGRSTLSAPQSLSSKL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgatgagcttcaatcggcactcgacagacgcgctgctaacggcaccctgaga
caactcacagtctaccccaccgctacatcctcatcctcattctcttcctcatcctcatcc
tcatcctcatcgttcgatttggcttcctctaaaagaccgctcgtcgacttctcaagcaac
gactatctcagcctcgcgacttcttcgcgtgttcgtgccgactttgcctccatggtcact
tccaacccttcgctctcctctcaacttgggagtgcaggttcccgactgcttgacggtaac
tcttccattcacgaagcgaccgaactcgagctcaccgagcactttgcatcttcctccgcc
ggcttactgttcaactcgggctatgaagccaacgtttcgctactaagtacgctacctcaa
cccagagacgtggtgatctacgacgaacttgtacacgcttctgtacacgatggactacga
aggtcacgtgtctccacccatcttcgaattcctttccggcataattcggttgaacacttg
gaagagatacttgagagattgatacaagatggtacactgacagcagcaactaacagcaac
gcttcaggtgctagaaatatctggttggcggtggagagtgtttattcgatggacggcgat
gtgtgccctctacaatcactgttggacgccatgtcgagatatgtcgatgacaagcgtatt
tgcgctattgtggacgaagcacattcgacagcgctgtatggtgtgcgtggaaggggtctg
atcaacgctcttggcttgcaagcagacagaaggatcgctgctcgtttgatgacgtttggt
aaagcatggggtgcttctggggccattgtgttgtgcagcaaagtggcaagacattatctc
atcaattatgcaagaccattcatcttcagtaccgcgctaggctacccacagctcacctcg
attctcgcttcgttcaattcgatcaaggacggcactgcgcaacgtgcggcttgcagaaca
tttgcaaactcccgaaggctcgttgatgggttcgaagctgtgatccgagcgcaactatcg
gatgcaacaagaagcattgctttgccgccccatctccggcccgaaactcaacttgaaaca
cagcccaagcagaagccggaccagggagaggagcacaatcatgactttgtcagctggtcc
atgcaacagccttcgcccatcatcccactgctcacagccgacgctcgagagctggcggca
catctgagagcaaatggtttattggctaggcccatctgctacccaacggtacccaaaggc
gaagatagagtaaggatctgtgttcatgctgacaacacagcagaagatatagatcggctc
atcgaatgcgttcggatgtggaccgaggaggctcaagggcaacgaataggcaacgtagtc
aatggtcgctcaacactgtcagcacctcagtcgctgtcgtccaaactgtaa

DBGET integrated database retrieval system