KEGG   Ustilago maydis: UMAG_01672Help
Entry
UMAG_01672        CDS       T01021                                 

Definition
(RefSeq) putative succinate--CoA ligase (GDP-forming) subunit alpha
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
uma  Ustilago maydis
Pathway
uma00020  Citrate cycle (TCA cycle)
uma00640  Propanoate metabolism
uma01100  Metabolic pathways
uma01110  Biosynthesis of secondary metabolites
uma01130  Biosynthesis of antibiotics
uma01200  Carbon metabolism
Module
uma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
uma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:uma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UMAG_01672
   00640 Propanoate metabolism
    UMAG_01672
Enzymes [BR:uma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     UMAG_01672
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     UMAG_01672
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 23562601
NCBI-ProteinID: XP_011387655
UniProt: A0A0D1E476
Position
3
AA seq 330 aa AA seqDB search
MFKHAAASLSRPLARGFSSSAARASYEDTIKNLLINKDSRVICQGFTGKTGTFHCQQALE
YGTKLVGGVSPKKAGQTHLGLPVFGSVKEAVRETKPHASVLYVPPPGAADAIIEAIENEV
PLIVAITEGIPQKDEIRVAAALRSQSKSRLVGPNCPGIINPEGCKIGIMPGHIHTPGRIG
IVSRSGTLTYEAVNQTTQVGLGQSLCVGIGGDPFPGSTTLDLVKLLLDHDKSEGIVLIGE
IGGSMEEDAAEYLAKYNKTRANPKPVVAFIAGRTAPPGRRMGHAGAIIAGGKGGADDKVK
ALTEAGAIVADSPAKIGALMKQAMQNAGLA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagcacgcagctgcctctctcagccggcctttggcacgaggcttctcgtcctcg
gctgctcgcgcttcgtacgaggacacgatcaagaacctgctcatcaacaaggactctcgc
gtcatctgccagggtttcaccggtaagaccggaactttccactgccaacaagctctcgaa
tacggcaccaagcttgttggtggtgtttcgcccaagaaggccggtcagactcaccttggc
ctgcccgtttttggctcggtcaaggaggcagttcgtgaaaccaagccgcacgcttcggtg
ctgtacgttccgccacctggtgctgctgacgccatcatcgaggcgatcgagaacgaagtt
cccttgatcgtcgctatcaccgaaggcattccgcagaaggacgaaattcgcgtcgctgct
gcgttgcgatcgcagagcaagtctcgattggtaggtcccaactgcccaggaatcattaac
cccgagggttgcaagatcggcatcatgcccggtcacattcacacgcctggccgaatcggc
attgtctcgcgttccggaaccttgacctacgaggcggtcaaccagaccactcaggtgggt
ctcggacaatcgctctgcgtcggtatcggcggtgacccgttccccggctcgaccactttg
gatctggtcaaactgttgcttgaccacgacaagtcggaaggtatcgttcttatcggtgag
attggtggaagtatggaggaggatgcggctgaatatctcgccaagtacaacaagacgcgt
gccaaccccaagccggtggtcgccttcatcgccggtcgaaccgcgcctcctggcaggagg
atgggtcacgccggtgccatcatcgcaggtggtaagggcggtgccgatgacaaggtcaag
gctttgaccgaggctggtgctatcgtcgccgattcccccgccaagatcggtgcgctcatg
aagcaggctatgcagaacgccggtttggcataa

DBGET integrated database retrieval system