KEGG   Ustilago maydis: UMAG_01945Help
Entry
UMAG_01945        CDS       T01021                                 

Definition
(RefSeq) putative invertase (sucrose hydrolyzing enzyme)
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
uma  Ustilago maydis
Pathway
uma00052  Galactose metabolism
uma00500  Starch and sucrose metabolism
uma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:uma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    UMAG_01945
   00500 Starch and sucrose metabolism
    UMAG_01945
Enzymes [BR:uma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     UMAG_01945
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 23562811
NCBI-ProteinID: XP_011387865
UniProt: A0A0D1E3W7
Position
3
AA seq 602 aa AA seqDB search
MKSILVGAALATFATFVSAAPSTIDPFDFREADLVYPRMNYDSAQHDARALGKGQCLNSN
GSSLAGYQPALYTEPVRPQIHFSPTVNFMNDPNGLVYSNGKWHLFYQYNPTENVAGNQHW
GHAVSTDLYHWENLPIAIAPEKEGEGIFSGNAVIDFENTSGFFNESTPKDQRIVAFYTLN
TPTSQTQHLAYSSDGVHFTKYPEAVISRNQTQFRDPKAFWDEKSSRWIVALALSQEFGIV
FYSSPNLKDWTEVSRFQSSGILGYQYECPDLFQVPIEGGPDDGKMMYVLAISINPGALVG
GSFVQYWVGDWDGSKFTPRDNAVRTMDFSKDFYAFSSWNNSPGKKAYAIAWANNWQYTNQ
VPTSPFRSIQSLPRELTLKYYRPTPQFGDLILNNKPANLSALRSKTLYKSDNGNSATNKT
VHLKGKGAFDITATFKLPASSKITYNTIASFEIFAGDGKQSVKTGIQMGEPAVAYIDRRG
AGPSFAAENPFFTDKTSGIVRYAANYTSASDGGSDQYVLGPLPTSAYLDTAGKDQYIKLQ
AVVDRSVIEVFVNDGELAGTSVFYFDNDEIPAKVTVSIGDNQIKLVDLEVTALDSIWSKC
NK
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccatcttggttggtgccgcgctggcgactttcgccacgtttgtctcggccgct
ccctcgactatcgaccctttcgactttcgggaggccgacctcgtctaccctagaatgaat
tatgactcagctcagcacgatgccagagctctcggcaaaggacagtgcctcaattcgaac
ggcagctcgctagccggctaccagccggctctctacaccgagcctgtccggcctcagatc
cacttttcacccacggtcaacttcatgaacgatcccaacggtctcgtctacagcaatgga
aagtggcacctcttttatcagtacaatcccaccgaaaacgttgccggcaaccagcactgg
ggtcatgccgtctcgaccgacctgtaccactgggagaatttgcccatcgccatcgctcct
gaaaaggagggcgagggaatctttagtggtaatgcagtcatcgactttgaaaacaccagt
ggctttttcaacgagtcgacacccaaggatcagcgcatcgtggccttttatacgctcaac
acgccaacttcgcagacgcagcacctcgcctactcgtcggacggtgtccactttaccaag
tatcccgaagccgtcatctcgcgcaaccaaacccagttccgtgaccccaaggccttttgg
gacgaaaagtcgtcgcgttggattgttgccctggcgctctcgcaggagtttggcatagtc
ttctactcctcgcctaacctgaaggattggaccgaggtgagccgcttccagtcgtccggt
atcctcggctaccagtacgaatgtcccgacctcttccaggtgccgatcgagggagggccc
gatgacggcaagatgatgtacgttttggccatctcgatcaatcctggtgctctcgtgggc
ggatctttcgtacaatactgggttggcgactgggatggctccaagttcacccctcgcgac
aatgctgtaaggactatggactttagtaaggatttctatgctttcagcagctggaacaac
agccctggaaagaaggcctatgccattgcctgggctaacaactggcagtacaccaaccag
gtgcccacttcgcccttccgttcgatccagagtctgccgcgtgagcttacgctcaagtac
tatcgcccgactccccaatttggcgacctgatcctgaacaacaagccggccaacctgtct
gccctccgaagcaagaccctgtacaaatctgacaatggcaacagcgcaaccaacaagact
gttcacctcaagggcaagggcgcgttcgacatcacggcaacgttcaagctgcctgccagc
agcaagatcacttacaacacgatcgcctcgtttgagatttttgctggcgatggcaagcag
agcgtcaagacgggtatccagatgggcgagcctgctgttgcctacatcgaccgtcgaggt
gctggtccctcgtttgccgctgagaacccgttcttcaccgacaagacctcgggtattgtc
cgctacgctgccaactacacctctgcatccgatggcgggtctgaccagtacgttctcgga
cctctcccgacatcggcctatctcgacactgctggcaaggatcagtacatcaagctgcag
gccgttgtcgacaggtcagtgatcgaggtgtttgtcaacgacggtgaactggccggcacc
tcggtgttctactttgacaacgacgagattcctgccaaggtgactgtttcgattggtgac
aaccagatcaagctggtcgatctcgaggtcactgcacttgactcgatttggtccaagtgc
aacaagtga

DBGET integrated database retrieval system