KEGG   Ustilago maydis: UMAG_02453Help
Entry
UMAG_02453        CDS       T01021                                 

Definition
(RefSeq) putative superoxide dismutase SOD2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
uma  Ustilago maydis
Pathway
uma04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:uma00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    UMAG_02453
Enzymes [BR:uma01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     UMAG_02453
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 23563195
NCBI-ProteinID: XP_011388737
UniProt: A0A0D1E1Y3
Position
5
AA seq 227 aa AA seqDB search
MLRTALTRSSGAVKASSRSFVASAPAAVRAKHTLPDLAFDYGALEPAISSKIMELHHTKH
HQTYVNGLNQAEEQLSEAIHKKDVKSAIALQKAINFNGGGHINHTLFWENLAPQKNGGGE
LSSGALKDAIDRDFGGLDQLKSKFNAQIAAIQGSGWGWLGYNPQTKKLDIVTTANQDPLL
SHVPLIGVDAWEHAFYLQYQNVKADYFKAIWDVINFKAAEERLKKAQ
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgcactgcccttactcgatcgtccggagccgtcaaggcgtcgtcgcgcagtttt
gtcgcctctgcccctgcggccgtgcgagccaagcacacgcttcccgacctggctttcgac
tacggtgcactcgagcccgccatttcatccaagatcatggagctacaccacaccaagcac
caccagacctatgtcaacggtctcaaccaggcggaagagcagctctctgaagcgatccac
aagaaggacgtcaagtcggcaatcgctcttcagaaagcgatcaactttaacggcggtggt
cacatcaaccacactctcttttgggagaatctggccccgcagaagaatggcggtggtgag
ttgagcagcggcgctctcaaggacgctatcgaccgagactttggtggtttggaccagctc
aagtccaagttcaatgctcagatcgctgccatccagggttccggttggggttggctcggc
tacaacccgcagaccaagaagctcgacattgtcactaccgccaaccaggaccctctgctc
tcgcatgtgcctctgatcggtgtcgacgcttgggaacatgccttctacctccagtaccag
aacgtcaaggccgactacttcaaggccatctgggacgtcattaatttcaaggctgccgag
gagcgtctcaagaaagctcagtag

DBGET integrated database retrieval system