KEGG   Ustilago maydis: UMAG_03839Help
Entry
UMAG_03839        CDS       T01021                                 

Definition
(RefSeq) hypothetical protein
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
uma  Ustilago maydis
Pathway
uma00780  Biotin metabolism
uma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:uma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    UMAG_03839
Enzymes [BR:uma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     UMAG_03839
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     UMAG_03839
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     UMAG_03839
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     UMAG_03839
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_N BPL_LplA_LipB GATase_3 ThuA
Motif
Other DBs
NCBI-GeneID: 23564188
NCBI-ProteinID: XP_011390273
UniProt: A0A0D1CNK9
Position
10
AA seq 863 aa AA seqDB search
MSDVLVYSGPGVSTSALHHTLKTLRTLLTTYDVKTVDAKTLALDPWQKGTALVVLPGGRD
LPYVSELARPFTRNIDDNIAPSSAPERTASRQLRNYVESGGNFVGICAGAYYASSHCTFE
KGTDMEVDGERPFLRFFPGTCQGTVYPGFVYESDKGARIVDIERVTGHSQKDQWRCHYNG
GGAFMNADTWAERGVEVLACYTKAQTDDLLLDIDLNGGTAWKRPNYDGQAAVVLCSVGLG
KALLFGTHPEFPLLATSTPVLLAENGQVDAQEHKDHKERARQLRLHEQRRLQWLHELFTQ
RLGLRSELPQWAASAAVSAAGDAAAGNTIAAGTAIETDEPKLQPIFLALIGKDLQGLTDD
IVRKLAAERSTSATPHIQGYNDCSALKNATFASIKDSNDVIHFSVADAKSILEAQKLCSS
ADYDAFSKPVVPAPVSDEAAAQDLPTQDKEVDLDLVPKYVLVCKPARPSVDMVAYWNICE
YEKHLLHFREVNLQRERSKEQGHWSTWRAPFDPFHPFGASSGGFSGVEYQFGTPMLYTQM
VTSTQTMLDRNIRLLSALPVGTTFFATQQMSGRGRGGNRWISPKGCLQFSAVFRVPVSMA
SKTVFLQYLSGLAVVEGIRIALGDSEAGRAVAQKVRIKWPNDIYAEIPRVDSDASLATGA
SARAKTATFELGGKRYAKLGGILVNSQFSGGNEFVLVSGCGVNCLNARPTTSVSDLISIH
NRAMTASNAEPSTLLAPITQEKLAGAILSTFDSIWKTFMQHEGDFRPFVDKYRQVWLHSD
QETTLTSDAIRASATEAEEENVRIVGISSDFGLLQAVPRSSNVFSNDARAWSDTKESKMG
GIIQLQPDGNSFDMLQNLVKRKA
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgtacttgtctattcggggccgggcgtttccacttcggcactgcaccatacg
ctcaagacgctccgtacgcttctcactacatacgacgtcaagacggtggatgccaaaacg
ctagcactcgatccatggcagaagggaaccgcactcgtcgttcttcctggtggtcgcgat
ttgccgtatgtctctgaactggctcgaccgttcacccgaaatattgacgacaatatcgca
ccttcgagtgcgcccgagcgaaccgcctcgcgccaactacgcaattatgtcgagtcgggc
ggcaactttgtgggaatttgtgcaggtgcctactacgcatcgagccactgcaccttcgaa
aagggtaccgacatggaggtggacggagagcggccgtttctgcgctttttcccggggacg
tgccaagggacagtatatcctggctttgtgtatgagtcggacaaaggagctcgaatcgtt
gatatcgagcgtgtgacgggccacagccaaaaggatcaatggagatgccactacaacggt
ggcggcgcgtttatgaatgcagacacgtgggccgaacgtggcgtagaagtgttggcttgc
tacactaaggctcaaacggatgatcttctacttgatattgacttgaacggcggaacagct
tggaaacgaccaaactacgacggccaagcggcagtcgtgctctgctcggtaggactgggc
aaggctctgttgttcgggacacaccccgagttcccacttctggcgacctcaacaccggtg
ctgctggcagaaaacggccaggttgatgcgcaggaacacaaagaccacaaagaacgagcc
agacaactgcggctgcacgaacagcgccgtctgcaatggctgcacgagctgttcacccag
cggctcggactgcgctcggaactgccacagtgggctgcatctgcagcagtgtcggccgca
ggagatgctgctgctggcaacacaatcgcggctggcacagccatcgagacagacgaaccc
aagctgcaacccatcttccttgctctgatcggcaaggatttgcaggggctcaccgacgac
attgtgcgaaagcttgctgcagaacgatcaaccagtgccacgccacacattcaaggttac
aacgactgctccgcgctcaaaaacgcaacgtttgcgagcatcaaggactcgaacgacgtc
atacacttttcagtggcagatgcgaaaagcatcctagaggctcagaagctgtgttcgtcc
gccgactacgatgctttctccaaacccgtcgtgcccgctccagtttctgatgaggcggct
gcgcaagatttgccgacgcaggacaaggaggtagacctggacttggtgccaaagtacgtg
ctggtctgtaagccagcgcgaccctctgtcgacatggttgcctactggaacatttgcgag
tacgaaaagcatctgctgcactttcgtgaggtgaatctgcagagggagcgcagcaaggag
cagggacactggtccacgtggcgtgcgccgttcgacccgttccatccgtttggcgcctct
agcggcggcttttcaggtgtcgagtatcaattcggcacgccaatgctgtatacgcagatg
gtgacttcgacacaaacgatgctcgacaggaacatccgtttgctctctgctttaccggtt
ggaacgaccttcttcgcaacgcagcagatgagtggtcgaggacgtggaggtaaccgatgg
atctcacccaagggctgccttcagttctccgccgtgttccgtgttccggtctcgatggca
agcaagaccgtctttctgcagtacctttccggtctagctgtcgtcgaaggcattcgcatc
gcgctgggcgacagtgaagcgggtcgagcggtagcgcagaaagtacgcatcaagtggccg
aacgacatctatgccgagattcctcgcgttgactcggatgcttccctggcgacgggcgcg
agtgcaagagccaagacggccacgtttgagttgggcggtaaacgatatgcgaaactcggc
ggtatcctggtcaattcgcagttcagcggtggtaatgagtttgtcctcgtttctggttgc
ggtgtcaactgtctcaacgctcggcctactacgtctgtctctgatctgatttcgatccac
aatcgagctatgacggcgtccaacgctgagccgtccacgttgcttgcgcccataacacaa
gagaaactggccggggcaatcctgtcaacgtttgattcgatctggaagacgttcatgcaa
cacgagggcgatttcagaccgttcgtcgacaagtacaggcaagtgtggctgcacagcgat
caggagacgacgttgacgtcagacgctattcgagctagcgccacggaagccgaggaagaa
aacgttaggatcgtaggtatttcgtccgactttggactgttgcaggcggtgccgaggagc
tcgaatgtgtttagcaacgatgcgagggcgtggagcgatacgaaggaatcgaaaatggga
gggatcatccaattgcaacctgacggcaattcgtttgatatgctacagaacttggtcaag
cgaaaggcctag

DBGET integrated database retrieval system