KEGG   Ustilago maydis: UMAG_05076
Entry
UMAG_05076        CDS       T01021                                 

Definition
(RefSeq) hypothetical protein
  KO
K22004  trans-aconitate decarboxylase [EC:4.1.1.113]
Organism
uma  Ustilago maydis
Pathway
uma00660  C5-Branched dibasic acid metabolism
uma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:uma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    UMAG_05076
Enzymes [BR:uma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.113  trans-aconitate decarboxylase
     UMAG_05076
SSDB
Motif
Pfam: Lyase_1 ADSL_C Dor1
Other DBs
NCBI-GeneID: 23565066
NCBI-ProteinID: XP_011388155
UniProt: A0A0D1E1M1
Position
4
AA seq 493 aa
MAPALNANPTTKRDELSAPSASHKLGMSSMASRAAGGGLKLTGLPDLSDSAGTLSDIFGT
PQMREIWSDQNRVACYLEIEAALAIVQADLGIIPKNAAHEIVEHCRVQEIDWALYKQKTE
LIGYPVLGIVQQLVANCKDGLGEYCHWGATTQDITDTATVMQIRQSLTLVKQRLDSIVSS
LEHLAEQHRNVPMAARSNLKQAVPITFGFKMARFLATFRRHQQRLVELEKRVYTLEFGGA
AGNLSSLGDQGIATHDALAKMLDLAPAEIAWHTEHDRFAEVGTFLGLLTGTLAKLATDIK
LMSQTEVGEVGEPFISNRGSSSTMPQKNNPISCVYIHACAANVRQGAAALLDAMQSDHER
GTGPWEIIWVQLPLMMNWTSAALNNADFVLRGLQVFPDAMQHNLDLSKGLIVSEAVMMGL
GNTLGRQYAHDAVYECCRTAFVQDRPLLDVLLENHEIASKLDRTELEKLCDPANYLGQCS
QWIDRVLSRPSSA
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggcacctgcactcaacgcaaaccctaccacgaaacgcgacgagctgagcgctccgtcg
gcatcgcacaagctcggcatgtcgagcatggcgagcagggcggcaggcggcggtctcaag
ctcactggtctgcccgatctctcggactcggcaggaacgctgagcgacattttcggtacg
ccgcagatgcgcgagatctggtcggaccagaaccgtgtggcgtgctatctcgagatcgaa
gcggcgctcgcgattgtgcaggcggatctcgggatcatccccaagaatgcggcacacgag
atcgtcgaacactgccgcgttcaagagatcgactgggctctgtacaagcaaaagaccgag
ctgatcggctaccccgtgctgggcatcgtgcagcagctcgtcgccaactgcaaagatggt
ctcggcgagtactgtcactggggcgccacaacgcaggatatcactgacaccgccaccgtc
atgcagatccgccagtcgctcacgctcgtcaagcagagactcgacagcatcgtctcgagc
ctcgagcatctcgccgagcagcatcgcaacgtgcccatggcggctcgttccaacctcaag
caggcggtaccgatcacgtttggcttcaagatggcgcgcttcctcgccacgttccgccga
caccagcagcgtctcgtcgagctcgaaaagcgcgtctacacgctcgagtttggcggtgca
gcgggcaacttgtcgtcgctgggtgaccagggcattgcgacgcacgatgcgcttgccaag
atgctcgacctggcgcccgccgagattgcgtggcacacggaacacgaccgcttcgccgag
gtaggtaccttcctcggcctgctcactggaacgcttgccaaactcgccaccgacatcaag
ctcatgtcgcagaccgaggtgggcgaggtgggcgagccgtttatctcgaaccgcggctcg
tcgtcgacgatgccacagaagaacaatccgatctcgtgtgtctacattcacgcgtgtgcg
gcgaatgtgcgtcagggcgctgcagcgctactcgatgccatgcagtctgatcacgaacgt
ggcacgggtccctgggagatcatctgggtccagctgccactcatgatgaactggacctcg
gccgctctcaacaacgccgactttgtcctgcgcggcctccaggtgttcccagacgcaatg
caacacaacctggacctctcgaaagggctcatcgtctcggaagccgtcatgatgggtctc
ggtaacacgctcggccgtcagtacgcacacgacgccgtctacgaatgctgtcgaaccgcg
ttcgtccaagacagaccgctcctcgacgtcctcctcgaaaatcacgagatcgcctccaaa
ctagaccgcaccgagcttgaaaaactctgtgatcccgccaactacctcggccagtgttcg
cagtggatcgatcgcgtgctgtctcgcccatcgtcggcctga

DBGET integrated database retrieval system