KEGG   Ustilago maydis: UMAG_05504Help
Entry
UMAG_05504        CDS       T01021                                 

Definition
(RefSeq) hypothetical protein
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
uma  Ustilago maydis
Pathway
uma00270  Cysteine and methionine metabolism
uma00480  Glutathione metabolism
uma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:uma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    UMAG_05504
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    UMAG_05504
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uma04147]
    UMAG_05504
Enzymes [BR:uma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     UMAG_05504
Exosome [BR:uma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UMAG_05504
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSH_synth_ATP GSH_synthase
Motif
Other DBs
NCBI-GeneID: 23565378
NCBI-ProteinID: XP_011391829
UniProt: A0A0D1DRI0
Position
18
AA seq 542 aa AA seqDB search
MSTPILPAWPPSLSDEARDYLSHQATDYALSHGIVYRPLPTPPSAAPPTSSTIHAPFSLF
PSPFPRTLFDKAQSIQPAYDLLYAQVSSNHTFLQRVIGDSVVQVDSFQKQLWDIYVTVKD
DLVQPLSLGLFRSDYLLHDAQSESKAADEMGSRSGQLELKQVEFNTISASFGALCTKVNG
LHRHLSSTTNYLGVGKDLDKLENLPENKAQDVLVGGLAAAHAAYLNQQGYEAPAAKNVYV
LFVVQEGERNAFDQRPLEHALQGKGIRVVRQSFAEIASRMTLKPDDAKRTLLLNHPVLGL
IEVSTVYFRAGYGPSDYTSESEWNTRKQLERSLAIKCPSIAVQLAGAKKVQQVLAEPDQL
ESLLSNLGADASTAQKLRETFTDLYPLDESPLGKKGYELATTAPQNYVLKPQREGGGNNV
YRHDIPPFLAQIESCSPSSLAYNVSKKQAYILMSLIKPPAGLGNYLVKSATATTPGTPVL
AKDTVSELGVYGAVLFQNTETDTPVEIKHHQSGGYLLRTKGRDSDEGGVAVGFSVIDSPF
LI
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacaccaatactaccagcctggccaccaagcctctccgatgaggctcgagactac
ctctcgcaccaggccaccgactatgctctttcccacggaatcgtctaccgccccctccct
accccaccttccgccgccccgcctacctccagcaccatccatgcccccttctcgctcttc
ccctcaccctttccacgcacgcttttcgacaaggcacaatccatccaaccagcatacgac
cttctttacgcacaagtctcgtccaaccacaccttcctccaacgtgtgatcggcgattcc
gtcgtccaggtcgactcgtttcaaaagcagctctgggacatctacgtcacggtcaaagac
gatcttgtccagccgcttagtctaggtctgttcagaagcgattacctgctacacgatgcg
cagagcgagtcaaaggcagcagacgaaatgggtagtagatcgggccagttggagttgaaa
caagtcgagttcaacacgatcagcgcatccttcggtgccttgtgcaccaaagttaatggc
ctacatcggcatctttcgagtactacgaattatttgggtgtcggaaaggatctcgacaag
ctcgaaaacttgccagagaacaaggcgcaggatgtgctggttggagggttggctgctgcc
catgctgcctatctgaaccagcagggatacgaggcacccgccgcgaagaatgtttacgtc
ctcttcgtagtccaagagggagaaaggaatgctttcgatcagcgtccgctcgaacatgca
cttcagggtaaggggattcgagtcgttcgacagagctttgccgagatcgcttcacgaatg
acgttgaaaccagacgacgccaagcgtacactactgctgaaccacccggtgctgggattg
atcgaggtcagcacggtctacttccgcgcagggtatggtccctcggactacaccagtgag
tccgaatggaacactcgaaagcaactggaacgcagccttgcgatcaaatgcccctcgatc
gctgtacaacttgccggggcgaaaaaggtgcaacaggtgcttgctgagccggatcagctc
gaatctctgctctccaatctcggcgcggatgcttcgaccgcgcaaaagctgcgagagact
tttaccgacctgtatccactcgacgagtcgccgctcggtaagaaaggatacgaactcgcc
accaccgcaccgcagaactacgtgctcaaaccgcaacgcgaaggcggaggaaacaacgtt
taccgccatgacatcccgcccttcctcgctcaaattgaatcttgctccccctcttccctc
gcatacaatgtttccaagaaacaagcctacatcctcatgagcctgatcaagccccccgcc
ggtttgggtaactacctcgtcaaatcagccaccgcaacaacacctggcacacccgtactc
gccaaagacaccgtctcggaactcggcgtctacggtgctgtcctcttccaaaacaccgag
acagacaccccagtcgaaatcaaacaccaccaatccggtggatatctcttaagaactaag
ggaagagacagcgacgagggcggtgtggctgtcggattctctgtcatcgattcacctttc
ttgatctag

DBGET integrated database retrieval system