KEGG   Ustilago maydis: UMAG_06019Help
Entry
UMAG_06019        CDS       T01021                                 

Definition
(RefSeq) putative ca2+/calmodulin-dependent ser/thr protein kinase type I
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
uma  Ustilago maydis
Brite
KEGG Orthology (KO) [BR:uma00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uma01001]
    UMAG_06019
Enzymes [BR:uma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     UMAG_06019
Protein kinases [BR:uma01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   UMAG_06019
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo YrbL-PhoP_reg APH TetR_C_27
Motif
Other DBs
NCBI-GeneID: 23565744
NCBI-ProteinID: XP_011392393
UniProt: A0A0D1BUZ1
Position
21
AA seq 425 aa AA seqDB search
MPFHNPLAKQPDSYVKKKEYDFKKTLGEGTFGIVRQATWKAADPPINVAVKVISKRILRG
HDEIVKDEMNVLKGLDQPHVVKFLDWFESKDKYYLVFEEATGGELFERILSRGRFTELDA
CRTIRAVLSAIQYLHHHNIVHRDIKPENILYRTKAEDANVVLVDFGIAAHMKDDNEVLTS
VCGSFGYAAPEILAKKGHGKAVDMWSLGVITYTMLCGYTPFRSDDAAALAAETQRGKVEF
HDRYWKNVSNEAKDFVKACLTVDPKKRLTADQGMSHPWLTEHSEETQGVHDISAGLRENY
RKRWKSAIAAVRASTKFRTFAQLASESRSGSQASLQTSDSSTAFADDPGKISPPTKRELY
SESEDEQDGEDNQWFDTEDGSAARGNDATLADAASSQSENEPGWVEKLENKLDDLHLHSS
SKSSE
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgccattccacaatccgctggcaaagcagccagattcctacgtcaagaagaaggagtac
gatttcaaaaagacgctcggagaaggtacattcggcattgttcgacaagcaacatggaaa
gcagcggatccacccatcaacgtagcagtcaaggtgatcagcaagcgcatccttcgtgga
cacgatgagattgtcaaagacgagatgaacgtgctcaagggtcttgatcagccgcacgtg
gtcaaattccttgactggttcgagagcaaagacaagtactacctcgtatttgaagaagcg
acaggtggcgagttgttcgaacgtatcttgtcgcgcggacggttcacggagctagatgcg
tgtcggacgatccgggcggttctctcggcgattcagtaccttcaccatcacaatatcgtt
catcgcgacatcaaaccggaaaacattctctatcgaaccaaagcagaagatgccaacgtg
gtgcttgtcgactttggcattgccgcacatatgaaggacgacaacgaagtgctgacttcg
gtgtgcggaagctttggctatgctgcacccgagatcctcgccaagaaagggcacggcaag
gcggtcgatatgtggagcctgggcgtgattacctatacgatgctgtgtggctatacaccc
tttcgttccgacgatgcggcggcgttggcagctgaaacgcagcggggcaaggtcgaattc
catgatcgatactggaagaatgtcagcaacgaagccaaggactttgtcaaggcgtgcctc
actgtggatcccaagaaacgcctcaccgcggaccaaggcatgtctcacccatggctcacc
gaacacagcgaagagacacaaggtgtacacgatatttcggcgggcttgcgcgaaaactat
cgaaagcgctggaagtcggccatcgcagcggtacgtgcatcgaccaagtttcgcacgttc
gctcagcttgccagcgagagtcgctcaggcagtcaggcctctttgcaaacgtcggattca
tcgacggcgtttgcagatgatccaggcaagatttcaccgcccaccaaacgtgaactgtac
agtgaaagtgaagacgagcaggacggagaagacaaccagtggttcgataccgaagacggc
agcgccgcgaggggtaacgatgccacgcttgccgatgcagcctcgagccagtcggaaaac
gagccaggatgggtcgagaagctcgagaataagcttgatgatttgcatctgcattcttcc
agcaagtcaagtgaataa

DBGET integrated database retrieval system