KEGG   Ustilago maydis: UMAG_10410Help
Entry
UMAG_10410        CDS       T01021                                 

Definition
(RefSeq) putative ATP-dependent RNA helicase HAS1
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
uma  Ustilago maydis
Brite
KEGG Orthology (KO) [BR:uma00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:uma03041]
    UMAG_10410
   03009 Ribosome biogenesis [BR:uma03009]
    UMAG_10410
Enzymes [BR:uma01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     UMAG_10410
Spliceosome [BR:uma03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    UMAG_10410
Ribosome biogenesis [BR:uma03009]
 Eukaryotic type
  90S particles
   Helicases
    UMAG_10410
  Pre-60S particles
    UMAG_10410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 ResIII
Motif
Other DBs
NCBI-GeneID: 23566448
NCBI-ProteinID: XP_011390763
UniProt: Q4P6N0
Position
12
AA seq 574 aa AA seqDB search
MAPHKSDDVDAEAELASQLAADVAAAESSAATKAKASSASSSSTPAAERQPFSILDLSEP
TRKAIDAMGFKTMTEVQARCIPPLMAGKDVLGAAQTGSGKTLSFLIPAIEMLHRLKFKPR
NGTGAIIISPTRELALQIFGVAKELMAHHHQTFGIIMGGANRRAEADKLQKGVNLIVATP
GRLLDHLQNTKGFVFSNLKALCIDEADRILEIGFEDEMRQIVKILPNDNRQSMLFSATQT
TKVQDLARISLRPGPLYINVHADLAASTVSRLEQGYVVCESDRRFLLLFTFLKKNAGKKI
IVFMSSCNSVKYHSDLLNFIDVPVLDLHGKQKQQKRTNTFFEYCNAPCGTLLCTDVAARG
LDIPSVDWIIQFDPPDDPRDYIHRVGRTARAGNSGKSLLFLLPTELGFLRFLKVAKVPLN
EYTFPSDKVANVQGQLEKLISKNYYLHQSARDGYRSYLQAYGSYSLKRIFDIHKLDLAKV
AKAYGFSVPPKVNITIGTGLKTSASSSSGSGGKRKEVDVDGEGEDADGEINPKRQQSDRR
AYYRKNHQNGGSKDHFRKSGANATGNKGGKQWSR
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggcgccccacaagagtgacgacgtggatgccgaggccgagcttgcctctcaacttgcg
gccgatgtcgctgctgccgagtcctcggccgctaccaaggccaaagcatcttctgcctcg
tcatccagcacaccggctgccgaaagacagcctttctccattctcgacctctcggaacca
acacgcaaagccattgacgctatggggttcaagactatgaccgaggtccaggcgcgttgc
attccgccgctcatggctggaaaggatgtgctgggcgctgctcaaaccggttctggaaag
acattgtcgtttctgatccccgctattgaaatgcttcacagactcaagttcaagccaaga
aatgggacaggggctatcatcatttctcctacccgtgaactcgcgcttcagattttcggt
gtggcaaaggagcttatggcacaccaccatcagaccttcggtatcatcatgggaggtgcc
aaccgacgtgcagaggcggacaagctgcaaaaaggtgttaatcttatcgtcgccactcct
ggtcgtttgctcgatcatctgcaaaacaccaaaggcttcgtcttttccaacctcaaagct
ctatgtatcgacgaggccgaccgtatcctcgagatcggtttcgaagatgagatgcgacag
attgtcaaaatcctacccaacgacaatcgacagagtatgctgttctcggctacacaaacg
accaaagtgcaagatctggcacgtatctcgctccgaccgggccctctctacatcaatgta
cacgctgatcttgccgccagcacagtgtcgcgtctcgagcagggctacgtcgtatgcgag
tccgatcgccgcttccttctgctgtttacatttctgaagaagaacgctggaaagaagatc
atcgtttttatgagctcatgcaactcggtcaagtaccactcggatctgctcaactttatc
gacgttcctgtactcgacctgcacggaaagcaaaagcaacagaaacgcaccaacaccttt
ttcgaatactgcaatgcgccttgcggcactttgctttgcaccgacgtggctgcacgaggt
cttgatatccccagcgtagattggatcatccagtttgacccacccgatgatccgcgcgac
tacattcaccgtgtgggtcgtaccgcgcgtgcgggtaatagtggaaagtcattgctcttc
ctcttgcccacagagctcggtttcttgcgcttcctcaaagtggcaaaggtgccgctgaat
gagtacactttcccttcggacaaggtggcaaacgtccaaggtcagctcgagaagctcatc
agcaagaactactacctgcaccaatctgcacgtgatgggtaccgatcgtatctgcaagcg
tacggctcgtactccctcaagcgcatctttgacattcacaagctcgatcttgccaaggtg
gccaaagcgtacggattttctgtgccgcccaaagtcaatatcacgattggaactggactg
aaaacgtcagcttcgagcagcagtggtagtggtggaaagaggaaagaggtggatgtagac
ggagagggcgaagacgcagatggcgagatcaacccaaagagacagcagagcgacagaagg
gcgtactaccgtaaaaatcaccagaatggtggcagcaaggatcactttcgtaagtctgga
gcgaatgcgacaggcaacaagggtggcaagcagtggtctcgttga

DBGET integrated database retrieval system