KEGG   Ustilago maydis: UMAG_10526Help
Entry
UMAG_10526        CDS       T01021                                 

Definition
(RefSeq) putative Hsp70 family ATPase SSB2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
uma  Ustilago maydis
Pathway
uma03040  Spliceosome
uma04141  Protein processing in endoplasmic reticulum
uma04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:uma00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    UMAG_10526
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    UMAG_10526
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    UMAG_10526
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:uma01009]
    UMAG_10526
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:uma03041]
    UMAG_10526
   03009 Ribosome biogenesis [BR:uma03009]
    UMAG_10526
   03110 Chaperones and folding catalysts [BR:uma03110]
    UMAG_10526
   04131 Membrane trafficking [BR:uma04131]
    UMAG_10526
   03051 Proteasome [BR:uma03051]
    UMAG_10526
   03029 Mitochondrial biogenesis [BR:uma03029]
    UMAG_10526
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uma04147]
    UMAG_10526
Protein phosphatases and associated proteins [BR:uma01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     UMAG_10526
Spliceosome [BR:uma03041]
 Complex B
  Other components
   Prp19 complex
    UMAG_10526
 Complex C
   Prp19-CDC5 complex
    UMAG_10526
Ribosome biogenesis [BR:uma03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    UMAG_10526
Chaperones and folding catalysts [BR:uma03110]
 Heat shock proteins
  HSP70 / DNAK
   UMAG_10526
Membrane trafficking [BR:uma04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    UMAG_10526
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    UMAG_10526
Proteasome [BR:uma03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    UMAG_10526
Mitochondrial biogenesis [BR:uma03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    UMAG_10526
Exosome [BR:uma04147]
 Exosomal proteins
  Proteins found in most exosomes
   UMAG_10526
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR Zincin_2
Motif
Other DBs
NCBI-GeneID: 23566546
NCBI-ProteinID: XP_011391166
UniProt: A0A0D1DSL7
Position
14
AA seq 619 aa AA seqDB search
MSSEVPATPVDDTVYQGAIGIDLGTTYSCVGWWVNERVEIIANDQGNRTTPSYVAFTESE
RLIGDAAKNQAAMNPKQTVFDAKRLIGRRYDDPDVKKDMQHWPFTVIDKDGSPFIEVNYL
GETKQFSPQEISSMVLTKMKEIAEAKIGKEVKKAVITVPAYFNDSQRLATKDAGSIAGLD
VLRIINEPTAAAIAYGLDSKSSTEKNVLIYDLGGGTFDVSLLNITGGVFAVKATAGDTHL
GGEDFDNALLDHFKKEFERKNKLDISGDARAVRRLRSACERAKRTLSSVTQTTVEVDSLF
QGVDFQANITRARFEEINAAAFKGTIEPVAKVLKDSKIPADKVDDIVLVGGSTRIPKIQS
LISEFFGGRQLNKSINPDEAVAYGAAVQAAVLTNQTSDKTADLLLLDVAPLSLGVAMQGD
VFGVVVPRNTPIPCNKTRVFTTVEDNQTQVTFPVYEGERTQCKDNRLLGEFELTGIPPQP
RGQAELLTTFEIDANGLLKVSAQEKITGRKANITITNSVGRLSSNEIEQMIKDAETFSKA
DKDFTAKHDAKNDLEAYVHSVEETISSPAANLKRPAKIQIEQELTKALELLEVQDASADE
YRRASLRLKRSMQKAFGGR
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcgaggttcctgctacccccgtcgacgacaccgtctaccagggcgccatcggt
attgaccttggtaccacctactcttgtgtcggttggtgggtcaatgagcgtgtcgaaatc
attgccaacgaccagggtaaccgcaccaccccctcgtacgtcgctttcaccgagagcgaa
cgtctcattggtgatgccgccaagaaccaggctgccatgaaccccaagcagaccgtcttc
gacgccaagcgtctcatcggtcgccgatacgatgaccctgacgtcaagaaggacatgcag
cactggcccttcaccgtcattgacaaggacggctcccccttcatcgaggtcaactacctc
ggcgagaccaagcagttctccccccaggagatttcctccatggtcctcaccaagatgaag
gagatcgccgaggccaagattggcaaggaggtcaagaaggccgtcatcaccgtccccgct
tacttcaacgactcgcagcgtctcgccaccaaggatgctggttccatcgctggtctcgat
gtcctccgtatcatcaacgagcccaccgctgccgccatcgcctacggtctcgactccaag
tcgtcgactgagaagaacgtcctcatctacgatctcggtggaggaactttcgatgtttcg
ctcctcaacatcaccggtggtgttttcgccgtcaaggccaccgctggtgacacccacctt
ggtggtgaggacttcgataacgcccttcttgaccacttcaagaaggagttcgagcgcaag
aacaagctcgacatctcgggtgacgcccgtgctgttcgccgtctccgttcagcctgtgag
cgtgctaagcgcaccttgtcgtcggtcacccagaccaccgtcgaggttgactcgctcttc
cagggtgtcgacttccaggccaacatcacccgtgcgcgattcgaggagatcaacgccgcc
gccttcaagggtaccattgagcccgtcgccaaggtgctcaaggactccaagatccccgcc
gacaaggtcgacgacattgtgcttgtcggtggttccacccgtatccccaagatccagtcg
ctcatctccgagttcttcggtggccgccagctcaacaagtcgattaaccccgacgaggct
gtcgcctacggtgccgctgtccaggccgccgtgctcaccaaccagaccagcgacaagacc
gccgacctcctccttcttgatgtcgctcctctttcgctcggtgttgccatgcagggtgac
gtgttcggtgttgtcgttccgcgtaacaccccgatcccatgcaacaagacgcgtgtcttc
accaccgttgaggacaaccagactcaggtcaccttccccgtttacgagggtgagcgaact
cagtgcaaggacaaccgtctccttggtgagttcgagctgactggtattccccctcagccc
cgtggtcaggccgagctcctgaccacctttgagattgacgccaacggtctgctcaaggtc
tccgctcaggagaagatcactggtcgcaaggccaacatcaccattaccaactcggtgggt
cgcctcagctccaacgagatcgagcagatgatcaaggacgccgagaccttctccaaggct
gacaaggacttcactgccaagcacgatgccaagaacgacctcgaggcatacgtccactcg
gtcgaggagaccatctcgagccccgccgccaacctcaagcgccccgccaagatccagatt
gagcaggagcttaccaaggctcttgagcttcttgaggtgcaggacgcttcggctgacgag
taccgccgtgcttcgctccgcctcaagcgctccatgcagaaggctttcggtggtcgttaa

DBGET integrated database retrieval system