KEGG   Ustilago maydis: UMAG_10598Help
Entry
UMAG_10598        CDS       T01021                                 

Definition
(RefSeq) putative nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
uma  Ustilago maydis
Pathway
uma00230  Purine metabolism
uma00240  Pyrimidine metabolism
uma01100  Metabolic pathways
uma01110  Biosynthesis of secondary metabolites
uma01130  Biosynthesis of antibiotics
Module
uma_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
uma_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
uma_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:uma00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    UMAG_10598
   00240 Pyrimidine metabolism
    UMAG_10598
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uma04131]
    UMAG_10598
Enzymes [BR:uma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     UMAG_10598
Membrane trafficking [BR:uma04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    UMAG_10598
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-GeneID: 23566605
NCBI-ProteinID: XP_011389199
UniProt: A0A0D1DZJ0
Position
6
AA seq 152 aa AA seqDB search
MATEQTYIMIKPDGVQRGIVGEIIKRFENRGYKIAALKMVHASEEHLEKHYKDLKGKKFF
PGLIKYMASGPVVCIVFEGKDAVKTGRVLLGATNPLDSAPGTIRGDFAIDVGRNVCHGSD
SVESAKAEIALWFGEQNPTIQYTRAVDSWIYE
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggctactgagcagacttacattatgatcaagcccgacggcgtgcagcgcggtattgtc
ggagagatcatcaagcgctttgagaaccgtggctacaagattgcagcgctcaagatggtg
cacgcctctgaggagcacctcgaaaagcactacaaggacctcaagggtaagaagttcttc
cccggccttatcaagtacatggcttccggccccgtcgtctgcatcgtcttcgaaggcaag
gacgccgtcaagaccggccgtgtccttctcggcgccaccaacccgctcgactctgccccc
ggaaccatccgtggcgacttcgccatcgacgtcggtcgcaacgtctgccacggctccgac
agcgtcgagagcgctaaggccgaaatcgccctctggttcggcgagcagaaccccaccatc
cagtacacccgcgccgtcgactcctggatctacgagtaa

DBGET integrated database retrieval system