KEGG   Ustilago maydis: UMAG_11310Help
Entry
UMAG_11310        CDS       T01021                                 

Definition
(RefSeq) hypothetical protein
  KO
K19785  nicotinamide-nucleotide adenylyltransferase [EC:2.7.7.1]
Organism
uma  Ustilago maydis
Pathway
uma00760  Nicotinate and nicotinamide metabolism
uma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:uma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    UMAG_11310
Enzymes [BR:uma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     UMAG_11310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like Prok-E2_A
Motif
Other DBs
NCBI-GeneID: 23567210
NCBI-ProteinID: XP_011387416
UniProt: A0A0D1E677
Position
2
AA seq 320 aa AA seqDB search
MKLASKLARTAASAATSNGSGVRLVYSTSSTWPFSSGESCKCSTGRAMDIAVLDSSFNPP
SRAHLALLVSRPILSDRNRSYDGHLLLFSTQNADKGAGKPGDASLTQRVEMMTLLAKDVE
RIQAASGDRVNVAVGLVDKPLIFAKSTLTWDLIKQQEQHGQVQSNARLHWVVGFDTLYRV
FQLKYYPSLQEFQQQCSQFFERERTTFVCARRDPSSYPQLSASELSREHVQQQANQEEDK
LLASEYVARWVRKGCIGMLDIDKEQAKLSSTRIRSLLKDASFDDGEKKSRLKELVPPLLV
EYLVESGIYRDGVEKVEPKC
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaagttagcaagcaagcttgcacgcaccgctgcttctgccgcaaccagcaatggctcg
ggagtccgtcttgtatactctacctcctcaacctggcccttttcttcgggcgaatcttgc
aaatgcagcactggccgcgcaatggacattgcggttctcgattcttccttcaatcccccg
tcccgtgctcacctcgccctactggtgtctcgacccattctttctgaccgaaaccgctcg
tatgatggtcacctcttactcttctcgacgcaaaacgcagacaaaggagcgggaaagccc
ggggatgcatctctcacacagcgcgtagagatgatgacgctcctggcaaaagacgtggag
cgcatacaagccgcctcgggagaccgtgtcaatgtcgccgttggcctggtagataaaccg
ctcatctttgcaaagtctactctcacctgggacctgatcaagcagcaagaacagcacgga
caagtacagtcgaatgccaggcttcactgggtcgttggattcgacacgctgtaccgtgtc
ttccagttgaaatactatccgtcgctgcaagaattccaacagcaatgctcgcagttcttc
gagcgagagcgtaccacgtttgtatgtgctcgacgcgacccgtcttcctaccctcagcta
tctgcatcggaattgtcgcgtgagcatgtccagcagcaggcaaaccaggaggaagacaag
ctgctcgcatccgaatacgtcgctcgctgggtgagaaaaggttgcataggcatgcttgac
atcgacaaggaacaagccaaactcagctcgacgaggattcgatctttgctgaaggatgcc
agctttgatgatggagagaagaagagccgcttaaaggagttggtgccaccgttgctggtc
gagtatttggtcgagtctggtatctatcgagacggtgtagaaaaagtggagccaaaatgt
tag

DBGET integrated database retrieval system