KEGG   Ustilago maydis: UMAG_11577Help
Entry
UMAG_11577        CDS       T01021                                 

Definition
(RefSeq) putative eukaryotic translation initiation factor eIF-3
  KO
K03254  translation initiation factor 3 subunit A
Organism
uma  Ustilago maydis
Pathway
uma03013  RNA transport
Brite
KEGG Orthology (KO) [BR:uma00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    UMAG_11577
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:uma03012]
    UMAG_11577
Translation factors [BR:uma03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    UMAG_11577
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI Peptidase_M15_2
Motif
Other DBs
NCBI-GeneID: 23567442
NCBI-ProteinID: XP_011391954
UniProt: Q4P358
Position
18
AA seq 1024 aa AA seqDB search
MPPFAKPETVLKRSEELINVGQHQAALAALNEIFTSRRFKQTPLQSLEPIMLRFVDLCVD
LKKGRMAKEGLMQYKNVSQNTNAQSIELVIKHFIKLADAKVVEAQSKADAAVGEIDVDDL
EESETPESMLLGSVSADQNKDRTDRVLVTPWLKFLWEAYRTALDILRNNARLEVPYQQIA
NQALKFCLQYQRKTEFRRLCEVLRQHLQNVARYSHHAHAINLTDQDTLQRHLDTRFAQLN
SAVELELWQEAFRSVEDIHNLLTMAKKAPRPAMMANYYEKLARIFMVSDNNLFHAAAWNR
YYALARSIAKSEQEHTQIASYVLISALAVPVISSNAPGTGNLHKSKSDFLQADHEARSRT
GRLTSLLGLSRTPTRAGLLKEALNRDILKKARPELRELYNILEVEFHPLSICAKIEPILA
SISQDAEMAKYVKPLHSVVLTRLFQQLSQVYDAVKLSKVMQLVSAFKAPHSYTPAEIEKF
CLNACKKGHLNIRIDHVAQAITFQDDVFSTDVHPAASASSEADNVGLQASPSELVRTQLS
RLATCLDTTLKTIDPTILADAQAAKRHVFARAVAAAEDEHKAAIARKALLARRKELLEEM
ATRKEREEAAARAERARAAAEAEQKRIAEEQKKREQDRLNKEVEAVRIEEAKKMAKSLQE
RGGLKLSEEELANLDTDKLVQMQVEQIEKEKKELAERLRLIHRRMDHLERAYRREEAPLL
SADYERQKQEDLQYHKAARITLLQTSKDKHAADLEIKKRLTRILPDYQQLRSIIEDKRRG
EFEERRRKATEQIELEKERRRQQVRDERRRERQEAEEAERRRVQEEQEARARAEEEERLA
EQRRVEEAQRAELEAKKRAEIEERRAKFQATADKQRQREEEAEANRRSRAAGTGAAPAQE
LAAADATWRRASGSPAPTQAESQRPPIFGAARTGGAGGWRERLAAKEAAGGNATAAPSAP
AAAPAPASSGAYRPGMFRAAAGAGAGGRTDRVAATPLPPAAAAAESDGFTEVKKNVYRPP
GRRA
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
atgcctccgttcgccaaacccgagaccgtcctgaaacggtccgaggaactcatcaatgtc
ggtcaacaccaggccgctttggccgcgctcaacgagattttcacctctcgtcgtttcaag
cagactcctctccagtcgcttgaacccatcatgctccgatttgtcgatctttgcgttgat
ctcaaaaagggaaggatggccaaggaaggtctgatgcaatacaagaacgtctcgcaaaac
acaaacgctcaatccatcgagctcgtcatcaagcactttatcaagctcgccgatgccaaa
gtcgtagaggctcagtccaaggccgatgccgccgttggtgaaattgacgtcgatgacctc
gaggagtccgagacccccgagagcatgctccttggctcggtcagcgctgaccagaacaag
gaccgcaccgatcgtgtcctcgtcacgccttggctcaagtttctctgggaggcctaccgt
accgcgctcgacattctccgcaacaatgctcgtctcgaggtgccctaccagcagatcgcc
aaccaggcactcaagttttgtcttcagtaccaacgcaaaaccgagttccgtcgtctctgc
gaagtcctccgtcagcatctccaaaacgttgcccgctactctcaccacgcccacgccatc
aacctcaccgaccaggacaccctccagcgtcacctcgacacccgctttgcgcagctcaac
tcggccgtcgaactcgaactctggcaagaggccttccgctccgtcgaggacatccacaac
ctcctcaccatggccaaaaaagctcctcgtcccgccatgatggccaactactacgagaag
ctcgcccgtatctttatggtctcggacaacaacctcttccatgccgctgcctggaaccgc
tactacgcccttgcacgctccatcgcaaagtccgagcaagaacacacccagatcgcctcg
tacgttctcattagcgccctcgccgtccccgtcatctcgtccaacgctcccggcaccggc
aacctgcacaagtccaagtccgactttctccaggccgaccacgaggctcgaagccgcacc
ggtcgtctcacctcgcttctcggcctcagtcgcacccccactcgcgccggtctgctcaag
gaggctctcaatcgcgacattctcaaaaaggcgcgtcccgagcttcgcgaactctacaac
atcctcgaggtcgaattccatcccctctccatctgcgccaagatcgagcccatcctcgcc
tcgatctcgcaggatgccgagatggcaaagtacgtcaagcctcttcactcggtcgttctc
actcgcctcttccagcagctcagccaggtctacgacgccgtcaagctctccaaggtgatg
cagctcgtctctgccttcaaagctcctcacagctacacgcccgccgaaatcgaaaagttc
tgcctcaacgcctgcaaaaagggtcacctcaacatccgcatcgaccacgttgcccaggcc
atcaccttccaggacgatgtcttctccaccgacgtccatcccgccgcttccgcctcgtcc
gaagctgacaacgttggtctgcaggcctccccctctgagctcgtgcgcacccagctcagc
cgactcgccacctgtctcgacaccacgctcaagaccatcgatcccaccatccttgccgat
gcgcaggctgccaagcgtcacgtttttgcgcgcgccgtcgctgccgccgaagacgagcac
aaggctgccattgcccgcaaggcgctcctcgcgcgtcgcaaggagctgctcgaggaaatg
gctacgcgcaaggagcgagaagaggcggccgcgcgtgccgaacgcgctcgtgctgccgcc
gaggccgaacagaagcgcatcgccgaagaacaaaagaagcgcgaacaggatcgccttaac
aaggaagtcgaggcggtgcgcatcgaggaagccaagaaaatggcaaagtcgttgcaagag
cgcggaggtctcaagctttccgaggaagaacttgccaatctggacacggacaaattggtc
cagatgcaggtagagcagatcgaaaaggaaaagaaggagcttgccgagcgtctgcgtctc
atccaccgccgaatggaccacctcgagcgtgcctaccgtcgcgaagaggctcccttgctt
tcggctgactacgaacgacagaagcaggaagacctgcaatatcacaaggcggctcgcatc
acgctgttgcagacttccaaggacaaacacgccgccgacctcgagatcaagaagcgtctc
acccgaatcttgcccgactaccagcagcttcgttccattatcgaggataaacgtcgcggc
gaatttgaagagcgaaggagaaaggctaccgagcagattgagctcgaaaaggaaaggcgt
cgtcagcaagtgcgcgacgagaggagacgcgagcgacaagaggccgaagaggccgaacgt
cgccgcgtccaagaggaacaagaggctcgtgctcgtgccgaggaggaggagcgcctcgcc
gagcagcgtcgtgtcgaagaggctcagcgcgccgagctcgaggccaagaagcgcgccgaa
atcgaggagcgaagggccaagttccaggcgaccgccgacaagcaacgacagcgcgaggag
gaggccgaggccaaccgtcgttctcgtgccgccggtactggtgctgcgcctgcacaagag
ttggccgctgctgatgctacatggcgccgtgctagtggcagccctgcacccactcaagcc
gagtcgcaacgtcctcccatctttggcgctgctcgtaccggtggcgctggaggctggcgt
gagcgcttggctgccaaggaggccgctggtggcaatgctactgctgctccttctgctcct
gctgccgctcctgcgcctgcctcttcgggagcctaccgacctggtatgttccgtgccgct
gccggtgctggcgctgggggacggacggatcgcgtggcggccactcctctccctcccgct
gccgcggctgccgagagcgacggctttaccgaggtcaagaagaacgtctaccgtcctcct
ggtcgtcgtgcctga

DBGET integrated database retrieval system