KEGG   Ursus maritimus (polar bear): 103656518Help
Entry
103656518         CDS       T03271                                 

Gene name
CREM
Definition
(RefSeq) cAMP responsive element modulator
  KO
K09052  cAMP response element modulator
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:umr00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103656518 (CREM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103656518 (CREM)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103656518 (CREM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf Rh5 TMCO5
Motif
Other DBs
NCBI-GeneID: 103656518
NCBI-ProteinID: XP_008682145
UniProt: A0A384BHW1
Position
Un
AA seq 360 aa AA seqDB search
MSKCGRKKYIKTNLRQMTMETIESQQDGSVTDSVAESESAHMQTQTGQNSIPTLAQVSVA
GSGTGRGSPAVTLVQLPSGQTVHVQGVIQTPQPSVIQSPQIQTVQVATIAETDESAESEG
VIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEEKSEEEGTPPNIATMAVPTSIYQT
STGQYIAIAQGGTIQISNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFV
PGSQVVVQDEETELAPSHMAAATGDMPTYQIRAPTTALPQGVVMAASPGSLHSPQQLAEE
ATRKRELRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKAE
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaatgtggcaggaaaaaatatattaagacaaatctaagacaaatgaccatggaa
acaattgaatctcagcaggatggaagtgtaacagattctgtggcagagagcgaatctgct
catatgcagacccagactggtcaaaattcaatccctactttagctcaggtttctgtagct
ggatcaggcaccggaagaggctccccagctgtaactcttgtacagttaccttcgggccag
actgtacatgtgcagggagtgattcagacaccacagccatcggttattcagtcgccacaa
atacaaactgttcaggtagcaacaattgcagagacagatgagtctgcagaatcagaaggt
gtaattgattctcataaacgtagagaaatcctttcacgaagaccctcttatagaaaaata
ctgaatgaactttcctctgatgtgcctggtgttcccaagattgaagaagaaaaatcagag
gaagaaggaacgccacctaacatcgctaccatggcagtaccgactagcatatatcagact
agcacggggcaatacattgctatagcccaaggtggaacaatccagatttctaacccagga
tctgatggtgttcagggactgcaggcattaacaatgacaaattcaggagctcctccgcca
ggtgctacaattgtacagtacgcagcacagtcagctgatggcacacagcagttctttgtc
ccaggcagccaggttgttgttcaagatgaggaaactgaacttgccccaagtcacatggct
gccgccactggtgacatgccgacttaccagatccgagcccctaccactgctttgccgcag
ggagtagtgatggctgcctcgccaggaagcttgcacagtccccagcaactagccgaggaa
gcaacacgcaaacgagagctgaggctaatgaaaaacagggaagctgcccgggagtgtcgc
aggaagaagaaagaatatgtcaaatgtcttgaaaatcgtgtggctgtgcttgaaaaccaa
aacaagactctcattgaggaactcaaggccctcaaagatctttattgccataaagcagag
taa

DBGET integrated database retrieval system