KEGG   Ursus maritimus (polar bear): 103657668Help
Entry
103657668         CDS       T03271                                 

Gene name
EIF3A
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr03013  RNA transport
Brite
KEGG Orthology (KO) [BR:umr00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    103657668 (EIF3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:umr03012]
    103657668 (EIF3A)
Translation factors [BR:umr03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    103657668 (EIF3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 103657668
NCBI-ProteinID: XP_008683300
UniProt: A0A384BME7
Position
Un
AA seq 1339 aa AA seqDB search
MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVD
LRKXKEGLYQYKNICQQVNIKSLEDVVRAYLKLAEEKTEAAKEESQQMVLDIEDLDNIQT
PESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQAFK
FCLQYTRKAEFRKLCDNLRMHLSQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSAISM
ELWQEAFKAVEDIHGLFTLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLYHLS
REMRKNLTQEEMQRMSTRVLLAIFSITPERTDIARLLDMDGIIVEKQRRLATLLGLQAPP
TRIGLINDMVRFNVLQYVVPEVKDLYNWLEVEFNPLKLCERVTKVLNWVREQPEKEPELQ
QYVPQLQNNTILRLLQQVAQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDLQVRID
HTSRTLSFGSDLNYATREDAPIGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPAHILQE
KEEQHQLAVTAYLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAELQKVR
KAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIEDLEELD
PDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKSAYEEQRIKDMDLW
EQQEEERITTMQLEREKALEHKNRMSRMLEDRDLFVMRLKAARQSVYEEKLKQFEERLAE
ERHNRLEERKRQRKEERRITYHREKEEEEQRRAEEQMLKEREERERAERAKREEELREYQ
ERVKKLEEVERKKRQRELEIEERERRREEERRLGDDPLSRKDSRWGDRDSEGTWRKGPEV
DSEWRRGPPEKEWRRGEGRDEERPHRREEDRPRRLGDEEERESSLRPDDDRIPRRGMDDD
RGPRRGLDEDRFSRRGADDDRPSWRNADDDRPPRRIGDEDRGSWRHADDDRPPRRGLDED
RGSWRTADEDRGPRRGMDEDRGPRRGGADDERSSWRNADDDRGPRRGMDDDRGPRRGLDD
DRGPWRSTDDDRISRRGADDDRGPWRNMDDDRIPRRGDDSRPGPWRPFVKPGGWREKEKA
REESWGPPRESRPSEEREWDREKERERENQDRDENDKDPEKERDRERERERDRERDGDRE
DRFRRPRDEGGWRRGPAEESSSWRDSNRREDRDRDDRRRERDERRDLRERRDDRDRRGPP
LRSEREEAGSWRRADDRKEERAEEREGPRRAPPPALSRDRDREREGEKEKASWRAEKDRE
SLRRTKNETDEDGWTTVRR
NT seq 4020 nt NT seq  +upstreamnt  +downstreamnt
atgccggcctatttccagaggccggaaaatgccctcaaacgcgccaacgaatttcttgag
gttggaaaaaagcagcctgccttggatgttctttatgatgttatgaaaagtaagaaacac
agaacatggcaaaagatacacgagccgattatgttgaaatacttggaactttgcgtggat
cttcggaagnataaagagggattatatcagtataagaacatttgtcaacaggtgaacatc
aaatctctagaggatgttgttagggcatatttgaaattggcagaggaaaaaactgaagcc
gctaaggaagaatctcagcagatggtcctagacatagaagatctggataatattcaaact
cctgagagtgttctcctaagtgccgtaagtggcgaagacactcaagatcgtaccgacaga
ctacttttaactccatgggttaaattcctttgggaatcatataggcagtgtttggacctt
cttcgaaacaattctagagtagagcgtctctaccatgatattgcccaacaagctttcaaa
ttctgcctccagtacacccgtaaggctgaattccgtaagctgtgtgacaatttgagaatg
cacttgtcacagatccaacgtcaccataaccagagtacagcaatcaatcttaataatcca
gagagccagtctatgcatttggaaaccaggcttgttcagttggacagtgctatcagcatg
gaattatggcaggaagcattcaaagctgtggaagatattcatggactattcaccttgtct
aaaaaaccaccgaaacctcagttgatggcaaattactataacaaagtttcaactgtgttt
tggaaatctggaaatgctctttttcatgcatctacactccatcgtctttaccatctgtcc
agagaaatgagaaagaatcttacacaagaagagatgcaaagaatgtctaccagagtcctt
ttggccattttttctattactcctgagcgtactgatattgctcgacttctggatatggat
ggcattatagtcgaaaaacagcgtcgccttgcaacactgctaggtcttcaagccccacca
acaagaattggccttattaatgatatggtcagattcaacgtactacagtatgttgtccct
gaagtgaaagacctttacaattggctggaagtggaatttaacccactaaaactctgtgag
agagtcacaaaggttctaaattgggttcgggaacaacctgaaaaggagccagagttgcaa
cagtatgttccgcagctgcagaacaacaccatactccgtcttctgcagcaggtggcacaa
atttatcagagcattgagttttctcgtttgacttctctggttccttttgttgatgctttc
caactggaacgggcaatagtagatgcagcgaggcactgtgacctgcaggttcgtattgac
cacacttctcggacacttagttttggatctgatttgaattacgctactcgagaagatgct
ccaattggtcctcatttgcaaagcatgccttcagaacagataagaaatcagctgacagct
atgtcttccgtacttgcaaaggcactggaagtcattaagccagctcatatactgcaagag
aaagaagaacagcatcagttggctgttactgcataccttaaaaattcacgaaaagagcat
cagcgtatcctggctcgccgtcagacaattgaggaaaggaaagagcgccttgagagtctg
aatattcagcgtgagaaagaagaattggagcagagggaggctgagctccagaaagtacgg
aaggctgaagaagagaggctgcgacaagaggcaaaggagagggagaaggagcgcatctta
caggaacatgaacaaatcaaaaagaaaactgtccgtgagcgtttggagcagatcaaaaaa
acagaactgggtgccaaagcattcaaagatatcgatatcgaagatcttgaagaattggat
ccggatttcatcatggctaaacaggttgaacaactagagaaagaaaagaaggaacttcag
gaacgtctgaagaatcaagagaagaagattgactattttgaaagagctaaacgcttagag
gaaatcccgttgataaagagtgcttatgaagaacagaggataaaagacatggatctgtgg
gaacaacaggaagaagaaagaattactactatgcaactagaacgtgaaaaggctcttgaa
cataagaatcgaatgtcacgaatgcttgaagacagagatttatttgtaatgcgactcaag
gctgcacgacagtctgtctatgaggaaaaacttaaacagtttgaggagcgattagcagaa
gaaaggcataatcgcttggaagaacgtaaaaggcaacgtaaagaagaacgcagaataacc
taccatagagaaaaggaagaggaggaacagaggagggcggaggaacaaatgctaaaagag
cgtgaagagagagagcgtgctgaacgggccaaacgcgaggaggagctacgagagtatcag
gagcgggtcaagaaattagaagaagtagaaaggaaaaaacgccaaagagagctggaaatt
gaagaaagggaacgacgcagagaggaagagagaagacttggtgatgatccactttctaga
aaggactctcgttggggagatagagattcagaaggcacatggaggaaaggacctgaagta
gattccgagtggagaagaggcccacccgagaaggagtggagacgtggagaggggcgggat
gaggaaaggcctcatagaagagaggaagatcgaccaaggcgtttgggggatgaggaagag
agagagtcttctcttagaccagatgatgatcgcattccccggcgtggcatggatgatgac
agaggtcctagacgcggtcttgatgaagaccggttctctcgccgtggggcagatgacgac
cggccttcctggcgtaacgcagatgatgacaggcctcccagacggattggtgatgaagac
agggggagctggcgtcatgcagatgatgatagaccacctagacggggactggatgaggac
agaggaagctggcgaacagccgatgaggacagaggaccaagacgtgggatggatgaggac
cgggggccacgtcgaggaggtgcagatgatgagcggtcttcctggcgtaatgctgatgat
gaccggggtcccaggcggggcatggatgatgaccggggtcccaggcgtgggctggatgat
gatcgaggaccttggaggagtactgatgatgacagaatttctaggcgcggtgcagatgat
gaccgtgggccttggagaaacatggatgacgatcggattcccagaaggggtgatgactca
agacctggtccctggagaccctttgtcaagccaggtggatggagagagaaagaaaaagcc
agagaagagagttggggtccacctcgagaatcgagaccatcagaagaacgtgaatgggat
agggaaaaagagagagagagagaaaaccaagatcgtgacgaaaacgacaaggacccagag
aaagaaagagaccgagagagagagcgagagcgggacagagagcgagatggggaccgagag
gaccgcttcagacgccctagggatgaaggaggctggagaagaggaccagcggaagaatct
tcgagctggagagattcaaatcgccgtgaagatagggatcgggatgaccgtcgtcgggag
agagatgagcgccgtgatctaagggagaggcgagatgacagggaccgaagaggacctcct
cttagatcagaacgtgaggaagcaggttcttggaggcgtgctgatgacaggaaagaggag
cgggccgaagagcgggaaggccctcgtcgtgctcctcccccagctctttcaagagaccgg
gaccgggaaagagaaggtgaaaaagagaaggcctcctggagagctgagaaagatagggaa
tcacttcgtcgtactaaaaacgagactgatgaagatggatggaccacggtacgacgttaa

DBGET integrated database retrieval system