KEGG   Ursus maritimus (polar bear): 103658444Help
Entry
103658444         CDS       T03271                                 

Definition
(RefSeq) cytosolic beta-glucosidase
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00500  Starch and sucrose metabolism
umr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103658444
Enzymes [BR:umr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     103658444
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase REC1
Motif
Other DBs
NCBI-GeneID: 103658444
NCBI-ProteinID: XP_008684139
UniProt: A0A384BPE6
Position
Un
AA seq 454 aa AA seqDB search
MNEGGWDADGKGPSVWDTFTHQGGERVFKNQTGDVACGSYTLWEEDLKCIKQLGLTHYRF
SLSWSRLLPDGTTGFINQKGIDYYNKIIDDLLTNGVTPIVTLYHYDLPQALEDKGGWLSE
TVIESFDKYARFCFSTFGDRVKQWITINEPNVFALLAYDLGIYAPGVPHFGTGAYQAAHN
LIKAHARSWHSYDSLFRKEQKGMVSLTIFAAWVEPADPNSVSDQEAAKRAMAFCLDFFAK
PIFTDGDYPEVVKSQIAFMSKKQGYPSSRLPEFTEEEKRMIKGTADFFAVHYYTTRLVKY
QENKKGELGFFQDVEIQIFPDPSWIRSLDWIYVVPWGIRKVLKYIKDTYNNPVIYITENG
FPQRDPASLDDTQRWEYFRQTFQELFKAIQLDKVNCKIYCLWSLLDNFEWIQGYNSRFGL
FHVDFEDPARPRVPYTLAKEYAKLIQNNGLEDHP
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaggaggctgggatgcagatggaaaaggccctagtgtctgggacacattcacc
catcagggaggagagagagttttcaagaaccagactggcgatgtagcttgtggcagctac
actctgtgggaggaagatttgaaatgtatcaaacagcttggattgactcattaccgcttc
tctctttcctggtcacgtctgttacctgatgggacgacaggtttcatcaaccagaaagga
attgactattacaacaagatcattgatgatttgttaactaatggggttacacccatagtg
accctctatcactatgatttgcctcaggccctagaagacaaaggtggttggttgtcggag
acagtcattgaatcctttgacaaatatgcccggttttgcttcagtacttttggagatcga
gtcaagcagtggatcaccataaatgagcctaatgtttttgcccttctggcatatgatttg
ggtatatatgctcctggtgtacctcactttggaactggagcttatcaggcagctcataat
ttgattaaagctcatgccagatcctggcacagctacgattccttattccgaaaagagcag
aagggcatggtgtccctaacaatttttgctgcctgggtggagccggcagatccgaactca
gtgtctgaccaggaagctgctaaaagagccatggctttctgtttggatttctttgctaaa
cccatatttactgatggtgattatccggaagttgtcaagtcccagattgccttcatgagt
aaaaagcaaggctatccatcatcaaggcttccagaatttacagaagaagagaagagaatg
attaaaggcactgctgatttctttgctgtgcattattatacaacccgcttagtcaagtac
caggagaataagaaaggagaactgggttttttccaagatgtggagattcaaatttttcca
gacccatcttggataagaagtttggattggatctatgtggtaccatggggaatacgtaaa
gtactgaaatacattaaggatacatataataaccctgtaatttacatcaccgagaatggg
tttccccagcgtgaccctgcatctcttgatgacactcagcgctgggagtatttcagacag
acgtttcaggaactgttcaaagctatccagcttgataaagtcaattgcaaaatatattgt
ctgtggtctcttctggataattttgagtggatccaagggtacaacagccggtttggtctc
ttccatgttgattttgaggatcctgctagacctcgagtgccttacacattggctaaggaa
tatgccaagctcatccaaaacaatggactagaggaccatccataa

DBGET integrated database retrieval system