KEGG   Ursus maritimus (polar bear): 103661047Help
Entry
103661047         CDS       T03271                                 

Gene name
BLVRB
Definition
(RefSeq) biliverdin reductase B
  KO
K05901  biliverdin reductase / flavin reductase [EC:1.3.1.24 1.5.1.30]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00740  Riboflavin metabolism
umr00860  Porphyrin and chlorophyll metabolism
umr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    103661047 (BLVRB)
   00860 Porphyrin and chlorophyll metabolism
    103661047 (BLVRB)
Enzymes [BR:umr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     103661047 (BLVRB)
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.30  flavin reductase (NADPH)
     103661047 (BLVRB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_10 NmrA Epimerase
Motif
Other DBs
NCBI-GeneID: 103661047
NCBI-ProteinID: XP_008686941
UniProt: A0A384BWH4
Position
Un
AA seq 205 aa AA seqDB search
MAVKKIAIFGATGRTGLTTLAQAVQAGYEVTVLVRDASRLPPEGPQPAHVVVGDVLQAAD
VDKTVAGQDAIIVLLGTRNDLSTGPPLCXTAHPWPXXXXHGVDKVVACTSAFLLWDPTKV
PPRLQDVTDDHIRMHKVLQESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDL
GHFMLSCLITDKYDGHNTYPSHQYE
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcaagaagattgccatcttcggcgccacgggcaggaccgggctcaccaccctg
gcgcaggcggtgcaagcaggttatgaggtgacagtgctggtgcgagacgcctccaggctg
cccccagaggggccccagccggcccacgtggtggtgggtgacgttctgcaggcggccgat
gtagacaagaccgtagctgggcaggatgccatcatcgtgctgctgggcacccgcaatgac
ctcagtactgggccccccctctgcnccacggcccacccctggccctnnnnnnnnnnncat
ggcgtggacaaggtcgtggcctgcacctcggccttccttctgtgggacccgaccaaggtg
cccccacgactgcaggatgtgaccgatgaccacatccggatgcacaaggtgctgcaggaa
tcgggcttgaagtacgtggccgtgatgccaccacacataggagaccagccgctgacgggg
gcctacacggtgaccctggatggacgagggccctccagggtcatctccaaacatgacctg
ggccacttcatgctgagctgcctcatcaccgataagtacgacgggcacaacacctacccc
tcccaccagtacgaatag

DBGET integrated database retrieval system