KEGG   Ursus maritimus (polar bear): 103661775Help
Entry
103661775         CDS       T03271                                 

Gene name
METTL14
Definition
(RefSeq) methyltransferase like 14
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
umr  Ursus maritimus (polar bear)
Brite
KEGG Orthology (KO) [BR:umr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:umr03019]
    103661775 (METTL14)
Enzymes [BR:umr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     103661775 (METTL14)
Messenger RNA biogenesis [BR:umr03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     103661775 (METTL14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70
Motif
Other DBs
NCBI-GeneID: 103661775
NCBI-ProteinID: XP_008687685
UniProt: A0A384BZU9
Position
Un
AA seq 456 aa AA seqDB search
MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAP
NAKRKYQDEGETDEDKMEEYKDELEMQQEEENLPYEEEIYKDSSTFLKGTQSLNPHNDYC
QHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIR
ELTPKFDVILLEPPLEEYYRETGITANEKCWTWDDIMKLEIDEIAAPRSFIFLWCGSGEG
LDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVKRST
DGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTV
GPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGG
TSAGRGRERNRSNFRGERGGFRGGRGGAHRGGFPPR
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggacagccgcttgcaggagatccgggagcggcagaagttacggcgacagctccttgcg
cagcagttgggagccgaaagtgccgacagcattggtgctgtgttaaatagcaaagatgag
cagagagaaattgctgaaacaagagaaacttgcagggcttcttatgatacgtctgctcca
aatgcaaaacgtaagtatcaggatgaaggagagacagatgaagacaaaatggaagaatat
aaggatgaattagaaatgcaacaggaagaagagaatttgccttatgaagaagagatttat
aaagattctagtacttttcttaagggaacgcagagtttaaatccccataatgattactgc
caacattttgtagacactggacatagacctcaaaatttcatcagggatgtaggtttggct
gacagatttgaagaataccctaaactgagggagctcatcaggctgaaggatgagttaata
gctaagtctaacactcctcctatgtacttacaagcagatatagaagcctttgacatcaga
gaactgacacctaaatttgatgtgattcttctggaaccccctttagaagaatattacaga
gaaactggcatcactgctaatgaaaaatgctggacttgggatgatattatgaagttagaa
attgatgagattgcagcacctcgatcatttatctttctctggtgtggttccggggaggga
ttggaccttggaagagtgtgtttacgcaagtggggttacagaagatgtgaagatatttgt
tggattaaaaccaataaaaacaatcctggaaagactaagactttagatccaaaggctgtg
ttccagagaacaaaggaacattgccttatggggatcaaaggaactgttaagcgtagcaca
gatggggacttcattcatgctaatgttgacattgacttgattatcacggaagaacctgaa
attggcaatatagaaaagcctgtagaaatttttcatataattgaacatttttgccttggt
agaagacgccttcatctgtttggaagagatagtacaattcgaccaggctggcttacagtt
ggaccaactcttacaaatagcaactataatgcagaaacatacgcatcctactttagtgct
cctaattcctacttgactggatgtacagaagaaattgagagacttcgaccaaaatcacct
cctcccaaatctaagtctgatcggggaggtggagctcccaggggtggaggaagaggtgga
acttctgccggccgtggacgagaaaggaatcgatctaacttccgaggcgaaagaggtggt
tttagggggggccgtggaggagcacacagaggtggctttccacctcggtaa

DBGET integrated database retrieval system