KEGG   Ursus maritimus (polar bear): 103663412Help
Entry
103663412         CDS       T03271                                 

Gene name
ARG1
Definition
(RefSeq) arginase 1
  KO
K01476  arginase [EC:3.5.3.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00220  Arginine biosynthesis
umr00330  Arginine and proline metabolism
umr01100  Metabolic pathways
umr01230  Biosynthesis of amino acids
umr05146  Amoebiasis
Module
umr_M00029  Urea cycle
umr_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    103663412 (ARG1)
   00330 Arginine and proline metabolism
    103663412 (ARG1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103663412 (ARG1)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     103663412 (ARG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 103663412
NCBI-ProteinID: XP_008689321
UniProt: A0A384C371
Position
Un
AA seq 322 aa AA seqDB search
MSSKSKFVGIIGAPFSKGQPRGGVEEGPAALRNAGLLEKLKEQECDVKDYGDVPFVDVPS
DPPFQIVKNPRSVGKANEQLAGVVAEVKKNGRTSLVLGGDHSMAVGSISGHARVHPDLCV
IWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLR
DVDPGEHYILKTLGIKYFSMTEVDKLGIGKVMEEALSYLLGRKKRRIHLSFDVDGLDPSF
TPATGTPVVGGLSYREGLYIAEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAIT
LSCFGVAREGNHKPIDYLNPPK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagttccaagtcaaaattcgtagggatcatcggagcgcctttctcgaagggccagcca
cgaggaggggtggaagaaggccccgcagcattgagaaacgctggcctgcttgagaaactg
aaagaacaagagtgtgatgtgaaagattatggggacgtgccctttgttgatgtccctagt
gatcctccctttcaaattgtgaagaatccaaggtccgtgggaaaagcgaacgagcagctg
gccggcgtggtggcggaagtcaagaagaatggaaggactagcctggtgctgggcggagat
cacagtatggcggttggaagcatctctggccatgccagggtccacccagatctctgtgtc
atttgggtggatgctcacaccgatatcaacactccactgacaactacaagtgggaacttg
cacggacaaccggtgtcttttctcctgaaggaactaaaaggaaagatccccgatgtacca
ggattctcctgggtgactccctgcatatctgccaaagatattgtgtatattggcctgaga
gacgtggaccctggggaacactacattttgaaaactctgggtattaaatatttttcaatg
actgaagtggataaactgggaattggcaaggtgatggaagaagccctcagctatctacta
ggaaggaaaaaaaggcgaattcatctgagctttgatgttgatggattggacccatctttc
acaccagctacgggcacaccagttgtgggaggtctgtcttacagagaaggtctctacatt
gcagaagaaatttacaaaacagggctactctcaggattagatataatggaagtgaacccc
tctctggggaagacaccagaagaagtaactcgaacagtgaacacagcagtagcaataacc
ttgtcttgctttggagttgcacgggagggtaatcataagcctattgactaccttaaccca
cctaagtaa

DBGET integrated database retrieval system