KEGG   Ursus maritimus (polar bear): 103664566Help
Entry
103664566         CDS       T03271                                 

Gene name
GRIA1
Definition
(RefSeq) glutamate ionotropic receptor AMPA type subunit 1
  KO
K05197  glutamate receptor 1
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04024  cAMP signaling pathway
umr04080  Neuroactive ligand-receptor interaction
umr04713  Circadian entrainment
umr04720  Long-term potentiation
umr04723  Retrograde endocannabinoid signaling
umr04724  Glutamatergic synapse
umr04728  Dopaminergic synapse
umr04730  Long-term depression
umr05014  Amyotrophic lateral sclerosis (ALS)
umr05031  Amphetamine addiction
umr05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    103664566 (GRIA1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103664566 (GRIA1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    103664566 (GRIA1)
   04728 Dopaminergic synapse
    103664566 (GRIA1)
   04720 Long-term potentiation
    103664566 (GRIA1)
   04730 Long-term depression
    103664566 (GRIA1)
   04723 Retrograde endocannabinoid signaling
    103664566 (GRIA1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103664566 (GRIA1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    103664566 (GRIA1)
  09165 Substance dependence
   05031 Amphetamine addiction
    103664566 (GRIA1)
   05033 Nicotine addiction
    103664566 (GRIA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:umr04040]
    103664566 (GRIA1)
Ion channels [BR:umr04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   103664566 (GRIA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 DUF659 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 103664566
NCBI-ProteinID: XP_008690690
UniProt: A0A384C8H5
Position
Un
AA seq 906 aa AA seqDB search
MQHIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDL
NKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKW
WYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRNSGAGTSGGGSGENGRVVSHDFPKSMQSIPCMSHSSGMP
LGATGL
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacatttttgccttcttctgcaccggtttcctaggcgcggtagtaggtgccaat
ttccccaacaatatccagatcgggggattatttccaaaccagcagtcacaggaacatgcc
gcttttagatttgctttgtcacaactcacagagcccccaaagctgctcccccagattgat
attgtgaacatcagcgacagctttgagatgacctatagattctgttcccagttctccaaa
ggagtctacgccatctttgggttttatgaacggagaactgtcaacatgctgacctccttc
tgtggggccctccatgtctgcttcattacaccgagctttcctgttgacacctccaatcag
tttgtccttcagctgcgccctgagctgcaggatgctcttatcagcatcatcgaccattac
aagtggcagaaatttgtctacatttatgatgccgaccggggtctgtccgtcctgcagaaa
gtcctggacacagctgctgagaagaactggcaggtgacagcagtcaacattttgaccacc
acagaggagggataccggatgctctttcaggacctggaaaagaaaaaggagcggctagtg
gtggtggactgtgaatcagaacgcctcaatgccatcttgggccagatcataaagctggag
aagaacggcatcggctaccactacatccttgcaaatctgggtttcatggatattgactta
aacaaattcaaggagagtggagcaaatgtgacaggtttccagttggtgaactacacagac
accatcccagccaagatcatgcagcagtggaagaacagcgacgctcgagaccacacccgg
gtggactggaagagacctaagtacacctctgcgctaacctacgatggggtgaaggtgatg
gctgaggcttttcagagcctgcggaggcagagaatcgatatatcccgtcgagggaatgct
ggggactgcctggctaaccccgctgtgccgtggggtcaggggatcgacatccagagagct
ctgcagcaggtgcggtttgaaggcttgacaggaaacgtgcagtttaatgagaagggacgc
cggaccaactacaccctccatgtgattgaaatgaaacatgatggcatccgaaagattggt
tactggaatgaagatgataagtttgtccctgcagccaccgatgctcaagccgggggggac
aattcaagtgtccagaataggacatacatcgtcactacaatcctagaagacccttatgtg
atgctcaagaagaacgccaaccagtttgagggcaatgaccgctacgagggctactgcgta
gagctggccgcagagattgccaagcacgtgggctactcctaccgccttgagattgtcagc
gatggaaaatatggagcccgtgaccctgacaccaaggcttggaatggcatggtgggagag
ctggtctatggaagagccgatgtggccgtagctcctttaactatcaccttggtccgggaa
gaggtgatagatttctccaagccatttatgagtttggggatctccatcatgataaaaaag
ccacagaagtccaaacctggggtcttctccttcctcgatcctttggcttatgagatttgg
atgtgcattgtctttgcctacattggagtgagtgtcgtccttttcctggtcagccgcttc
agcccctatgaatggcacagtgaagagtttgaggaagggcgggaccagacaaccagtgac
caatccaatgagtttgggatattcaacagtctgtggttctccctgggagcattcatgcaa
caaggatgtgacatttctcccaggtccctgtctggccgcatcgttggtggtgtctggtgg
ttcttcaccttgatcatcatctcctcatacacagccaacctggctgccttcctgaccgtg
gaaaggatggtgtctcccatcgagagtgctgaggacctagcaaagcagacggaaatcgct
tatgggaccctggaagcagggtccacgaaggagttcttcaggaggtctaaaattgcagtg
tttgagaagatgtggacatacatgaagtcagcagagccgtcagtttttgtgaggaccaca
gaggagggaatgatccgagtgaggaaatccaaaggcaaatacgcctaccttctggaatct
accatgaatgagtacattgagcagcggaaaccctgtgacaccatgaaggtgggaggtaac
ttggattccaaaggctatggcattgcaacgcccaaggggtccgccctgagaggtcccgta
aacctagcggttttgaaactcagtgagcaaggcgtcttagacaagctgaaaagcaaatgg
tggtacgataaaggggaatgtggaagcaaggactccggaagtaaggacaagacaagcgcc
ctgagcctcagcaatgtggcaggcgtgttctacatcctgatcggaggacttggactagcc
atgctggttgccttaatcgagttctgctacaaatcccgtagtgaatccaagcggatgaag
ggtttctgtttgatcccacagcaatccatcaatgaagccatacggacatcgacgctccca
cgtaacagtggggcaggaaccagcggtggtggtagtggagaaaatggccgggtagtcagc
catgacttccccaagtccatgcagtcaattccctgcatgagccacagttcagggatgccc
ttgggagccacgggattgtaa

DBGET integrated database retrieval system