KEGG   Ursus maritimus (polar bear): 103664585Help
Entry
103664585         CDS       T03271                                 

Gene name
GPX3
Definition
(RefSeq) glutathione peroxidase 3
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00480  Glutathione metabolism
umr00590  Arachidonic acid metabolism
umr01100  Metabolic pathways
umr04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103664585 (GPX3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103664585 (GPX3)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    103664585 (GPX3)
Enzymes [BR:umr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     103664585 (GPX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 103664585
NCBI-ProteinID: XP_008690716
UniProt: A0A384C750
Position
Un
AA seq 202 aa AA seqDB search
LALFQTDCHAGVSGTIYEYGALTIDGEEYIPFKQYAGKYILFVNVASYXGLTDQYLELNA
LQEELEPFGLVILGFPCNQFGKQEPGENSEILPSLKYVRPGGGFVPNFQLFEKGDVNGEK
EQKFYTFLKNSCPPTSELLGSPGRLFWEPMKVHDIRWNFEKFLVGPDGIPIMRWYHRTTV
STVKMDILAYMRRQAALAVKGK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
cttgctctgttccagacggactgccatgctggcgtgagtggtaccatctatgagtacgga
gccctcaccatcgacggggaggagtacatccccttcaagcagtacgctggcaaatacatc
ctctttgtcaacgtggccagctactgaggcctgacagaccagtaccttgaactgaatgca
ctacaggaagagcttgaaccatttggtctggtcattctgggcttcccctgcaaccaattt
ggaaaacaggagccaggagagaattcggaaatcctacccagcctcaagtatgtccgaccg
ggcgggggctttgtccccaatttccaactgtttgagaaaggggatgtgaacggggagaaa
gagcagaagttctacacgttcctgaagaactcctgccctcccacctcggagctcctgggc
tcacctggccgcctcttctgggaacccatgaaggtccatgacatccgctggaactttgag
aagttcctggtggggccagatggtatacccatcatgcgctggtaccaccggaccacggtc
agcactgtcaagatggacatcctggcctacatgaggcggcaggcagccctggccgtcaag
gggaagtaa

DBGET integrated database retrieval system