KEGG   Ursus maritimus (polar bear): 103664829Help
Entry
103664829         CDS       T03271                                 

Gene name
HTR4
Definition
(RefSeq) 5-hydroxytryptamine receptor 4
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04020  Calcium signaling pathway
umr04024  cAMP signaling pathway
umr04080  Neuroactive ligand-receptor interaction
umr04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    103664829 (HTR4)
   04024 cAMP signaling pathway
    103664829 (HTR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103664829 (HTR4)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    103664829 (HTR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:umr04030]
    103664829 (HTR4)
G protein-coupled receptors [BR:umr04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    103664829 (HTR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 103664829
NCBI-ProteinID: XP_008690967
UniProt: A0A384C832
Position
Un
AA seq 461 aa AA seqDB search
MHQWIKQTRSLPRGTYILAGEGTEQESTKYISEHELSSKEGFGSVEKAVLLAFLSAVILT
AILGNLLVMAAVCRDRQLRKIKTNYFIVSLAFVDLLVSVLVMPFGAIELVQDIWIYGEMF
CLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPMFI
SFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCIFMVNKPYAITCSVVAFYIPFLLMVLAY
YRIYVTAKEHAHQIQMLQRAGAPSEGRPQPADQHSTHRMRTETKAAKTLCIIMGCFCLCW
APFFVTNIVDPFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDE
RYRRPSILGQTVPCSTTTINGSTHVLRADLLRGRDISARHWIKPSMVGLFSGTLNGSCLL
GRQSVLXSPLSRDAVECGGQWESHCHPPATSSLMAAQPSDR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcatcagtggataaaacagacacggtctctgcctcgtggaacttacattctagctggg
gagggcacagaacaggaatccaccaaatacatttctgagcacgagctgagttccaaggag
ggttttgggtcagtggagaaggccgtgctgctcgcgtttctctcagcggttatcctaacg
gccatcttggggaacctgctggtgatggcggctgtgtgcagggacaggcagctcaggaag
ataaaaaccaattatttcattgtatctctcgcctttgtggatctgctggtttcggtgctg
gtgatgccctttggcgccatcgagctggttcaggacatctggatttacggggagatgttt
tgcctcgtccggacatctctagacgtcctgctcacgacggcatcgatttttcacctgtgc
tgcatttctctggataggtattatgccatctgctgccagcctctggtctataggaacaag
atgacccctctgcgcatcgcattaatgctgggaggctgctgggtcatccctatgtttatc
tcttttctccctataatgcaaggctggaataatattggcataattgatttgatagaaaaa
aggaagttcaaccagaactctaactctacctactgtatcttcatggtcaacaagccctac
gccatcacctgctccgtggtggccttctacatcccgtttctcctcatggtgctggcctat
taccgcatctatgtcacagcgaaggagcatgcccaccaaatccagatgttacaacgggca
ggagccccctcagaaggcaggccccagcccgccgaccagcacagcactcatcgcatgagg
acagagaccaaagcagccaagaccctgtgcatcatcatgggttgcttctgcctctgctgg
gctccattctttgtcaccaatatcgtggatccattcatagactacaccgttcctgggcag
gtatggacggctttcctctggcttggctacatcaactctgggttgaacccctttctctac
gccttcttgaataagtcttttcgacgtgccttcctcatcatcctctgctgtgatgatgag
cgctaccgaagaccctccatcctgggccagactgtcccctgttcaaccacaaccattaat
ggatccacacatgtgctaagggcagatttactgcgtggcagagacatttcagcaaggcac
tggataaaaccttccatggtgggtttattctcaggcacactgaatggtagctgtttgctg
ggaaggcagtctgtgctatgatctcccctctccagggatgcggtggagtgtggtggccaa
tgggagagtcactgccaccctccagcaacttcttccttgatggctgctcagcccagtgac
cgttag

DBGET integrated database retrieval system