KEGG   Ursus maritimus (polar bear): 103665295
Entry
103665295         CDS       T03271                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00230  Purine metabolism
umr00240  Pyrimidine metabolism
umr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103665295 (DCK)
   00240 Pyrimidine metabolism
    103665295 (DCK)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     103665295 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_18 AAA_28 AAA_33 Phage_lysozyme AAA_17 CoaE
Other DBs
NCBI-GeneID: 103665295
NCBI-ProteinID: XP_008691414
UniProt: A0A384CAC6
Position
Un
AA seq 260 aa
MATPPKRSCPSPATGSEGTRIKKIAIEGNIASGKTTFVNILKQVCEDWEVVPEPVARWCN
VQNAQGDCEELTTSQESGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLACLDGKIKDAE
KPVLFFERSIYSDRYVFASNLYESECMNETEWTIYQDWHDWMNQQFGQSLELDGIIYLRA
TPEKCLNRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDFLQEIPILTLDINE
DFKDRHDGLIEKVKEFLSTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggccaccccaccgaaaaggagctgcccatctcccgcgaccggctctgaggggacccgc
atcaagaaaattgccatcgaagggaacattgcttcagggaagacaacatttgtgaatatc
cttaaacaggtctgcgaagattgggaagtggttcctgaacctgttgccaggtggtgcaat
gttcagaatgctcaaggtgactgtgaggaactgacgacgtctcaggaaagtggtggaaat
gttcttcaaatgatgtatgaaaaacctgaacgatggtcttttacgttccagtcatatgcc
tgcctcagtcgaatacgagcccagcttgcctgtcttgatggcaagatcaaagatgcagag
aaacctgtattattttttgaacgatctatatatagcgacaggtatgtctttgcatctaat
ttgtatgaatctgaatgcatgaatgaaacagagtggacaatttatcaagactggcatgat
tggatgaatcaacagtttggccaaagccttgaactggatggaatcatttatcttcgagcc
actccagagaaatgcttgaataggatatatttacggggaagaaatgaagaacaaggcatt
cctcttgaatatttagagaagcttcactataagcatgagagctggctactgcatagaaca
ctgaaaaccaactttgattttctacaagaaatccctatcttaacactggatattaatgaa
gattttaaagatagacacgacggtctgattgaaaaggtcaaagaatttttgagcactttg
tga

DBGET integrated database retrieval system