KEGG   Ursus maritimus (polar bear): 103665664Help
Entry
103665664         CDS       T03271                                 

Gene name
CACNG5
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit gamma 5
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04260  Cardiac muscle contraction
umr04261  Adrenergic signaling in cardiomyocytes
umr04921  Oxytocin signaling pathway
umr05410  Hypertrophic cardiomyopathy (HCM)
umr05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
umr05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103665664 (CACNG5)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103665664 (CACNG5)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103665664 (CACNG5)
   04261 Adrenergic signaling in cardiomyocytes
    103665664 (CACNG5)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    103665664 (CACNG5)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    103665664 (CACNG5)
   05414 Dilated cardiomyopathy (DCM)
    103665664 (CACNG5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:umr04040]
    103665664 (CACNG5)
Ion channels [BR:umr04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103665664 (CACNG5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 SUR7 COPI_assoc DUF716 DUF4199
Motif
Other DBs
NCBI-GeneID: 103665664
NCBI-ProteinID: XP_008691867
UniProt: A0A384CAN1
Position
Un
AA seq 275 aa AA seqDB search
MSGCGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGVVLPQNQSMEIKMSLHSGLWR
VCFLAGEERGRCFTIEYVMPVNSQLTSESTVNVLKMIRSATPFPLVSLFFMFIGFILSNI
GHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDELLNRTKDAETYFNYKYGWSFA
FAAISFLLTESAGVMSVYLFMKRYTAEDLYRPHPGFYRPRLSNCSDYSGQFLHPDAWVRG
RSPSDISSDASLQMNSNYPALLKCPDYDQMSSSPC
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagtggctgcgggaggaaggccctaaccctgctgagcagcgtcttcgctgtctgtggc
ctgggcctcctgggcatcgccgtcagcaccgactactggctctacctggaggagggcgtg
gtcctgccccagaaccagagcatggagatcaagatgtccctgcactcgggcctgtggcgt
gtctgcttcctcgcaggtgaggagcggggacgctgcttcaccatagaatatgtgatgccc
gtgaacagccagctgacctcagagtccactgtcaatgttctcaaaatgattcgctcggcc
acgccgttccccctggtcagcctcttcttcatgttcattgggtttatcctgagcaacatt
ggacacatccgtccacacaggacaatactcgcctttgtctccggcatctttttcattctc
tcaggcctctctctggtcgtgggcctggttctctacatctccagcatcaacgatgagctg
ctcaacaggaccaaggacgcggagacctatttcaactacaagtacggatggtcctttgcc
ttcgctgccatctctttccttttgacggagagcgctggggtgatgtccgtatacctgttc
atgaagcggtacactgccgaggacctgtaccggccccaccccggcttctaccggccgcgc
ctgagcaattgctccgactactctggccagttcctacatccggacgcctgggtccggggc
cgcagcccctccgacatctccagtgacgcctccctgcagatgaacagcaattacccggcc
ttgctcaagtgccccgactacgaccagatgtcctcttccccctgctga

DBGET integrated database retrieval system