KEGG   Ursus maritimus (polar bear): 103665670Help
Entry
103665670         CDS       T03271                                 

Gene name
GNA13
Definition
(RefSeq) G protein subunit alpha 13
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04022  cGMP-PKG signaling pathway
umr04071  Sphingolipid signaling pathway
umr04072  Phospholipase D signaling pathway
umr04270  Vascular smooth muscle contraction
umr04371  Apelin signaling pathway
umr04611  Platelet activation
umr04730  Long-term depression
umr04810  Regulation of actin cytoskeleton
umr04928  Parathyroid hormone synthesis, secretion and action
umr05163  Human cytomegalovirus infection
umr05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103665670 (GNA13)
   04072 Phospholipase D signaling pathway
    103665670 (GNA13)
   04071 Sphingolipid signaling pathway
    103665670 (GNA13)
   04022 cGMP-PKG signaling pathway
    103665670 (GNA13)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103665670 (GNA13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103665670 (GNA13)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    103665670 (GNA13)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103665670 (GNA13)
  09156 Nervous system
   04730 Long-term depression
    103665670 (GNA13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103665670 (GNA13)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103665670 (GNA13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:umr04147]
    103665670 (GNA13)
   04031 GTP-binding proteins [BR:umr04031]
    103665670 (GNA13)
Exosome [BR:umr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103665670 (GNA13)
  Exosomal proteins of colorectal cancer cells
   103665670 (GNA13)
GTP-binding proteins [BR:umr04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    103665670 (GNA13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf
Motif
Other DBs
NCBI-GeneID: 103665670
NCBI-ProteinID: XP_008691877
UniProt: A0A384CAP0
Position
Un
AA seq 282 aa AA seqDB search
MRVLVDAREKLHIPWGDNSNQVNGDKMMAFDTRSPSASQGMVETQVFLQYLPAIRALWAD
SGIQNAYDRRREFQLGESVKYFLDNLDKLGEADYIPSQQDILLARRPTKGIHEYDFEIKN
VPFKMVDVGGQRSERKRWFECFDSVTSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETI
VNNRVFSNVSIILFLNKTDLLEEKVQIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRR
DQQQKPLYHHFTTAINTENIRLVFRDVKDTILHDNLKQLMLQ
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagggtgctggtggatgctcgagagaagcttcatattccgtggggagataactcaaac
caagttaacggagacaagatgatggcatttgacacccggtccccctcggcgtcccaggga
atggtggaaactcaagtctttttgcagtatctccctgctataagagcactgtgggcagac
agtggcatacagaatgcctatgaccggcgtcgagaatttcagttgggtgaatctgtaaaa
tatttcctggataacttggataaacttggagaagcagattacattccatcacaacaagat
attctgcttgccagaagacccaccaaaggcattcatgagtacgactttgaaatcaaaaat
gttcctttcaaaatggttgatgtgggtggtcaaagatcagagagaaaacgatggttcgaa
tgcttcgacagcgtgacgtcaatacttttccttgtttcctcaagcgagtttgaccaggtg
cttatggaagaccgactgaccaatcgccttacagaatctctgaacatttttgaaacaatc
gtcaataaccgggttttcagcaacgtctccataattctcttcttaaacaagacagatttg
cttgaggagaaagtgcaaattgtgagcatcaaagactatttcttagaatttgaaggggat
ccccactgcttaagagacgtccaaaaattcctggtggaatgtttccggaacaaacgccgg
gaccagcagcagaagcctttgtaccaccacttcaccactgctatcaacacggagaacatc
cgcctcgttttccgcgacgtgaaggacaccattcttcacgacaacctcaagcagctcatg
ctacagtga

DBGET integrated database retrieval system