KEGG   Ursus maritimus (polar bear): 103665951Help
Entry
103665951         CDS       T03271                                 

Gene name
SPHK1
Definition
(RefSeq) sphingosine kinase 1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00600  Sphingolipid metabolism
umr01100  Metabolic pathways
umr04020  Calcium signaling pathway
umr04071  Sphingolipid signaling pathway
umr04072  Phospholipase D signaling pathway
umr04370  VEGF signaling pathway
umr04371  Apelin signaling pathway
umr04666  Fc gamma R-mediated phagocytosis
umr05152  Tuberculosis
Module
umr_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    103665951 (SPHK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    103665951 (SPHK1)
   04371 Apelin signaling pathway
    103665951 (SPHK1)
   04020 Calcium signaling pathway
    103665951 (SPHK1)
   04072 Phospholipase D signaling pathway
    103665951 (SPHK1)
   04071 Sphingolipid signaling pathway
    103665951 (SPHK1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    103665951 (SPHK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103665951 (SPHK1)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     103665951 (SPHK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 103665951
NCBI-ProteinID: XP_008692207
UniProt: A0A384CBJ8
Position
Un
AA seq 554 aa AA seqDB search
MAGTYPNKSKSFPIWRPWLQVSEELEPGPVNSHLLSLKKKRGSQIRFFGEKLEVSQGGTG
DTEEPGNQEVNDKNEGGRAETVELGAPHLRGPLRTPPALSPLPHIPQTGDDAGASTAPAP
GGEGEPLSRHRDARLGSTDKELKAGAAAAGXATALGTPWQRELRVEVMDPAGGARSLLPR
PCRVLVLLNPRGGKGKALQLFRSHVQPLLVQADVSFTLMLTERRNHARELVRVEELGRWD
ALVVMSGDGLMHEVVNGLMERPDWETAIRKPLCSLPAGSGNALAASLNHYAGYEQVTNED
LLTNCTLLLCRRLLAPMNLLSLRTASGLRLFSVLSLAWGFIADVDLESEKFRRLGEMRFT
LGTFLRLAALRVYQGTLAYLPAERVVSQVPAPPAVERQDQQGPTDAHLVPLEEPVPPHWT
VVPEQDFVLVLALLHSHLGSEMFAAPMGRCAAGTMHLFYVRAGVSRAMLLRLFLAMEKGR
HMDYDCPYLVYVPVVAFRLEPKDGKGVFAVDGELMVSEAVQGQVHPDYVWMVSGCMEPPP
SQKPQQGPPPGEPL
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaacctatcctaataaaagcaagtcatttcccatctggcggccttggctccaa
gtttctgaagagctggagccaggcccagtaaattcccatttgctttctctgaagaagaaa
aggggctctcagatacggttctttggagagaaactggaggtcagtcagggcggcactgga
gacacagaggagcctgggaaccaggaggtgaatgacaagaatgaggggggcagagcagag
accgtggagctgggcgctccccacctcagggggccgctccggactccgccagcgctgtct
cctctccctcacatcccccagacaggggatgacgcgggtgcctccacggccccggctccg
ggcggggagggcgagcccctcagccggcaccgcgacgcccgcctgggcagcaccgataag
gagctgaaagcaggagccgccgccgcgggcnccgcgacagcgctggggacgccctggcag
cgggagctgcgagtcgaggttatggatccagcgggcggcgccaggagcctgctgccccgg
ccctgccgcgtgctggtcctgttaaacccgcgcggaggcaagggcaaggcgctgcagctc
ttccgcagccacgtgcagcctctgctggtccaagccgatgtctccttcacgctcatgcta
actgagcggcggaaccatgcacgggagctggtgcgggttgaggagctggggcgctgggat
gcgctggtggtcatgtctggagacgggctgatgcatgaggtggtgaacgggctcatggag
cggccagactgggagactgccatccggaagcccctgtgtagcctcccagctggctctggc
aatgcactggcagcttctttgaaccattatgctggctacgagcaggtgactaatgaggac
ctcctgaccaactgcacgctgctgctgtgtcgccgcctcctggcgcccatgaacctgctg
tcactgaggacagcctcagggctgcgcctcttctccgtgctgagcctggcttggggcttc
atcgccgacgtggatctggagagtgagaagtttcggcgtctaggggagatgcgcttcact
ctgggcaccttcctgcgcctggcggccctgcgagtctaccagggcacgctggcctacctc
cctgcagaaagggtggtctcccaggtgcccgccccccctgccgtggagcgccaggatcag
cagggtcccacggatgcccaccttgtacccctggaggagccggtgcccccgcactggact
gtggtcccggagcaggacttcgtgctcgtgctggcgctgctgcactcccacctgggcagc
gagatgtttgcggcccccatgggccgatgtgcggccggcaccatgcatctcttctatgtg
cgggcaggcgtgtctcgggccatgctgctgcgcctcttcctggccatggagaaggggagg
cacatggactatgactgtccctacttggtgtacgtgcctgtggttgccttccgcctggag
cccaaggacgggaagggtgtgtttgctgtggatggcgagttgatggtcagcgaggctgtg
cagggccaggtgcacccagactacgtctggatggtcagtggctgcatggagcccccaccc
agccagaagcctcagcagggaccacctccaggcgagcccttatga

DBGET integrated database retrieval system