KEGG   Ursus maritimus (polar bear): 103667619
Entry
103667619         CDS       T03271                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04080  Neuroactive ligand-receptor interaction
umr04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103667619 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103667619 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 103667619
NCBI-ProteinID: XP_008694016
UniProt: A0A384CGN6
Position
Un
AA seq 78 aa
MPKGEIRDLKYSKVGHLHIEACERPLLQPSDGKGLEEGNVRHLVQPRGSRNGPGPWQGGR
RKFRRQRPRLSHKGPMPF
NT seq 237 nt   +upstreamnt  +downstreamnt
atgcccaagggtgagatacgagatctcaagtactcaaaagtgggtcacctgcatattgaa
gcctgcgagaggcccctgctgcagccttctgatggcaaggggctggaggagggcaacgtc
cgccacctggtgcagcccagagggtcaagaaatggaccagggccctggcagggcgggcgg
aggaaatttcgccgccagcggccgcgcctctcccacaagggccccatgcctttctga

DBGET integrated database retrieval system