KEGG   Ursus maritimus (polar bear): 103669206Help
Entry
103669206         CDS       T03271                                 

Gene name
GGT5
Definition
(RefSeq) gamma-glutamyltransferase 5
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00430  Taurine and hypotaurine metabolism
umr00480  Glutathione metabolism
umr00590  Arachidonic acid metabolism
umr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103669206 (GGT5)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    103669206 (GGT5)
   00480 Glutathione metabolism
    103669206 (GGT5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:umr01002]
    103669206 (GGT5)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:umr04090]
    103669206 (GGT5)
Enzymes [BR:umr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     103669206 (GGT5)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     103669206 (GGT5)
    3.4.19.14  leukotriene-C4 hydrolase
     103669206 (GGT5)
Peptidases and inhibitors [BR:umr01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   103669206 (GGT5)
CD molecules [BR:umr04090]
 Proteins
  103669206 (GGT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 103669206
NCBI-ProteinID: XP_008695750
UniProt: A0A384CMT2
Position
Un
AA seq 538 aa AA seqDB search
MAQGRRATVSMVLLGLGLALAIVVPAVVLSRRHTSCGPQAFAHAAVAADSKVCSDIGRAI
LQQHGSPVDAAIAALVCTGVVNPQSMGLGGGVIFTIYNATTGKVEVINARETVPTNYVPG
LLDQCEQAQPLGTGAQWIGVPGELRGYAEAHRRHGRLPWAQLFQPTISLLRGDYHVPSIL
SQFLQSDFLRPSLSKTSLRQLFFNGTEPLRAQDPFPWPALAATLETVATEGAEAFYTGTL
GQMLLEDIADQGSGLTPQDLASFQAEVVEALEMPLGDYTLYSPPPPAGGAILSLILNVLQ
GFNFSSESVARSEGSVNLYHHLVETLKFAGGQRWRLWDPRSHLDIQNVSQDLLGEALAQH
IRGEDGSAVAATSTINTPFGAMLYSPRTGILLNNELLDLCWRRPPGSKVTPQPVPGERPP
SSMVPSILVNTAQGSKLVIGGAGGELIISAVAQAIINKLWLGFDLSTAIAAPILHVTSKG
HVEYEPRFSQEVQKGLQARGHNQTKSPFFLNVVQAVSQDGACVYAAADPRKGGEASGY
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaggccgcagggccacggtcagcatggtgctgctggggttggggctggccctg
gccattgtcgtgcctgccgtggtcctctcccgccgccacaccagctgcggcccccaggcc
tttgcccacgctgcggttgctgctgactccaaggtctgctcggacattggacgagccatc
ctccagcagcatggctcacctgtggatgctgccattgcggctctggtctgcactggagtc
gtcaaccctcagagcatgggcctgggcggaggggttatcttcaccatctacaatgcaacc
acggggaaggtggaagtcatcaatgccagggagacagtgcccaccaactacgtcccgggt
ctgctggaccagtgtgagcaggcccagccactgggcacaggggcccagtggatcggagtg
ccgggcgaactccgtggctatgccgaggcccaccgccgccatggccgcctgccctgggca
caactgttccagcccaccatctccctgctccgaggggactaccacgtgccctccatcctc
agtcagttcctgcagagtgacttcctacggccttccttgtccaagacgtccctcaggcag
ctctttttcaatggcacagaacccctgagggctcaggacccattcccctggcccgcactt
gccgccaccctggaaaccgtggccacggagggggcagaggctttctacacagggacgctg
ggccagatgctgctggaggacattgccgatcaaggcagcgggctgaccccgcaggacctg
gcatcatttcaggcggaggtagtggaggccctggagatgcccctgggggactacaccctg
tactcaccgccaccacctgcagggggcgcgattctcagcctcatcctcaacgtgctccaa
gggttcaacttctcctcggagtcggtggccaggtccgaggggagtgtgaacttgtaccat
caccttgtggagacgctcaagtttgccgggggacagaggtggcggctgtgggacccccgc
agccacctggatatccagaacgtctcccaggacctgctgggagaggctttggcccagcat
atccgcggggaggatggcagcgcggtggcggccaccagcaccatcaacacgcccttcggg
gcaatgctgtactcaccgcgcacgggcatcctcctcaacaacgagcttctggacctatgc
tggaggcgccccccgggctccaaagtcaccccccaacccgttccaggcgagcggcctcca
tcatccatggttccttccatcttggtcaacacagcccaggggtcaaagctggtgattggt
ggggctggtggggagctcatcatctctgctgtggcccaggccatcataaacaagctgtgg
cttggctttgacctgagcactgccattgcagcccccatcctgcacgtcaccagcaagggc
catgtggagtacgagccccgcttcagccaggaggtgcagaaggggctccaggccaggggc
cacaaccaaaccaagagtccctttttcctgaatgtggtccaggctgtgtcccaggacggg
gcctgtgtgtatgccgcagcggacccgaggaaaggtggggaggcctcaggctactga

DBGET integrated database retrieval system