KEGG   Ursus maritimus (polar bear): 103669484Help
Entry
103669484         CDS       T03271                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00561  Glycerolipid metabolism
umr01100  Metabolic pathways
umr04714  Thermogenesis
umr04723  Retrograde endocannabinoid signaling
umr04923  Regulation of lipolysis in adipocytes
Module
umr_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    103669484 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    103669484 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    103669484 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    103669484 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:umr01002]
    103669484 (MGLL)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103669484 (MGLL)
Peptidases [BR:umr01002]
 Serine Peptidases
  Family S33
   103669484 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 Abhydrolase_3 DLH LIDHydrolase Thioesterase Abhydrolase_5 Peptidase_S9 PGAP1 BAAT_C DUF1057 Abhydrolase_2 Chlorophyllase2 DUF1350 DUF2974 Ser_hydrolase FSH1 LCAT
Motif
Other DBs
NCBI-GeneID: 103669484
NCBI-ProteinID: XP_008696033
Position
Un
AA seq 313 aa AA seqDB search
METGLEDPFRMPEEGSPRRTPQSVPYQDLPHLVNADGQYLFCRSWKPTGTPRALIFVSHG
AGEHCGRYDELAQMLVGLGLLVFAHDHVGHGQSEGERMVVSDFHVFIRDVLQHVDTMQKD
YPGLPVFLLGHSMGGAIAILTAAERPSHFSGMVLISPLVLANPESATTFKVFAAKVLNLV
LPNMSLGPIDSSVLSRNKTEVDLYNSDPLICHAGLKVCFGNQLLNAVTRVERALPKLTLP
FLLLQGSADRLCDSKGAYLLMESAKSQDKTLKIYEGAYHVLHKELPEVTNSVFREINMWI
SQRTGAAGTGSPP
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaggacttgaagatcctttcagaatgccggaggaaggttctcccaggcggacc
ccgcagagcgttccgtaccaggacctccctcacctggtcaatgccgacggacagtacctg
ttctgcaggtcctggaaaccgacgggcacacccagggccctcatctttgtgtctcatgga
gccggggagcactgcggtcgctatgacgagctggctcagatgctggtggggctggggctg
ctggtattcgcccacgaccatgttggccatggacagagcgaaggggagaggatggtagtg
tctgacttccacgttttcatcagggacgtgttacagcacgtggataccatgcagaaagac
tacccagggcttcccgtcttccttctgggccactccatgggaggtgccatcgccatcctc
acggccgcggagaggccaagccacttctccggcatggtcctcatttcgcctttggttctt
gccaatcctgagtctgcaacaactttcaaggtctttgctgcgaaagttctcaaccttgtc
ctgccaaacatgtccctgggcccaattgactccagcgtgctctctcggaataagacagag
gtggacctttataactcggacccactcatctgccacgcgggtctgaaggtgtgcttcggc
aaccagctgctcaacgcggtgacgcgggtggagcgggccctccccaagctgaccttgccc
ttcctgctgctccagggctctgccgaccgcctttgcgacagcaaaggggcctacctgctc
atggagtccgccaagagccaggacaagacactcaagatttacgaaggtgcctaccacgtt
ctccacaaagagcttcctgaagtaaccaactccgtcttccgtgaaataaacatgtggatc
tcccaaaggacaggggcggcgggaacagggtccccaccctga

DBGET integrated database retrieval system