KEGG   Ursus maritimus (polar bear): 103672205
Entry
103672205         CDS       T03271                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
umr  Ursus maritimus (polar bear)
Brite
KEGG Orthology (KO) [BR:umr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:umr01002]
    103672205 (ERAP1)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     103672205 (ERAP1)
Peptidases and inhibitors [BR:umr01002]
 Metallo peptidases
  Family M1
   103672205 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 103672205
NCBI-ProteinID: XP_008699109
UniProt: A0A384CXA0
Position
Un
AA seq 942 aa
MISLSIKWPLATMLFLPSSLLILLTVSTRSWCQSSDTMSPKASNGTPFPWEKMRLPEHII
PVHYDLLIHANLTTLTFEGTTEIEITASQPTSTIILHSHRLQISKATLKKRDGERLSAEP
LTVLEYPAHEQIALLAPEPLVVGLPYVVVIDYAGHLSEHLQGFYKSTYRTKEGEVRVLAS
THFEPTAARMAFPCFDEPAFKANFSVKIRREPRHLAISNMPLVKSVTVAEGLLEDHFAVT
VKMSTYLVAFIISDFKSISKMTKSGVKVSIYAVPDKIHQADYALDTAVTLLEFYEDYFRI
PYPLPKQDLAAIPDFESGAMENWGLTTYRESILLFDAEKSSASDKLGITMTVSHELAHQW
FGNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVGDYFLGKCFDVMELDALNSSHPV
STAVENPAQIREMFDEVSYKKGACILNMLRDYLSAEAFKSGVVRYLQKYSYKNTRNEDLW
NSMASICPADDSQSMDGFCSRGPHSSSASHWWQEGLDVKTMMNTWTLQKGFPLITVTVRG
KNVHVRQELYRKGPEDASETGYLWHVPLTFITSKSDSIQRFLLKTKTDVLILPEEVEWIK
FNVGMNGYYIVHYEDDGWDSLTGLLTVAHTTISSNDRASLINNAFQLVSNGKLSIEKALD
LTLYLKRETEIMPVFQGLNELIPMYKLMEKRDMNEVENQFKAFLIRLLSDLIDNQTWTDE
GSVSQRMLRSQLLLLACVRKYQPCVQRAEAYFREWKDADGNLSLPSDVTLAVFAVGVQDP
EGWDFLYRKYQSSLSSSEKNKIEFALSISQDKDKLQWLLEESFKGDVIKIQEFPHILGAI
GRNPVGYPLAWQFLRENWDKLIQKFELGSASLTYMVIGTTSQFSTRARLEEVKEFFSSLK
EKGSQLRCVQQTIETIGENIRWMDKNFEKIRVWLQSEKLELL
NT seq 2829 nt   +upstreamnt  +downstreamnt
atgatatctctgtccatcaaatggccactggcaaccatgctgtttctaccgtcctcgctg
ttgattctcttaactgtgtcaactcgttcctggtgtcagagcagtgacactatgtctcca
aaagctagtaatgggactccattcccttgggagaaaatgcggcttcctgagcacatcatc
ccggttcattatgatctcctgatccatgcaaatctcaccactctgactttcgagggaacc
acggaaatcgaaatcacagccagccagcctactagtaccatcatcctgcacagtcaccgc
ctgcaaatatctaaggccaccctcaagaagagagacggggagaggctgtctgcagaacca
ttgaccgtcctggaatacccggctcatgagcagatcgcacttctggcccccgagcctctg
gttgttgggcttccgtatgtcgtcgtcatcgactacgctggccatctttctgagcacttg
caaggattttataaaagcacctacagaaccaaggaaggcgaagtgagagtgcttgcatca
acacactttgaacccactgcagcgagaatggcgtttccctgctttgatgaacccgccttc
aaagcgaatttttcagtcaagatcagaagggagccaagacacctcgccatctccaatatg
ccgctggttaagtctgtgactgtcgccgaaggactcctcgaagaccattttgctgttact
gtgaagatgagcacctacctcgtggccttcattatctcagactttaagtctattagcaag
atgaccaagagcggagtcaaggtttccatatatgctgtgcctgacaagatacatcaggca
gattatgccctggataccgcagtgactcttctagaattttacgaggattatttcaggatt
ccatatcccttacccaaacaagatcttgctgccattcctgactttgagagcggtgctatg
gaaaactggggactgaccacatacagagaatctattctcttgtttgacgctgagaagtct
tctgcgtcggataagcttggcattacgatgacggtgtcgcatgaactcgcccaccagtgg
tttgggaacctcgtcaccatggaatggtggaatgatctttggttaaacgagggatttgcc
aagtttatggagtttgtgtccgtcagtgtgactcatcctgaactgaaagttggagattat
ttcctcggcaagtgttttgacgtgatggagctggatgcgttaaattcgtcacaccctgtg
tccacagctgtggagaatcctgctcagattcgcgagatgtttgatgaggtttcttataaa
aagggagcttgtattctgaatatgctaagggattatctcagtgccgaagcatttaaaagc
ggtgttgtacgttatctccagaagtacagctacaaaaacacgagaaatgaggacctgtgg
aacagtatggcaagtatttgccctgcagatgactcacagagcatggacggcttttgctcc
aggggtccacattcatcttcagcctcacactggtggcaggaaggccttgacgtaaaaacc
atgatgaacacgtggacgctgcagaaaggctttcccctgataaccgtcacggtgagaggg
aagaacgtacacgtgaggcaggagctctacaggaaaggacccgaggacgcctcagaaact
gggtacctgtggcatgttccattgaccttcattaccagcaaatcagactccatccaaaga
tttttgctgaagacaaaaacagatgtgctcatcctcccagaagaggtagaatggatcaaa
tttaatgtcggaatgaacggctattacattgtgcattacgaggatgacggatgggattct
ttgactggccttttaacagtagcacacacgacaatcagcagcaacgatcgggccagtctc
atcaacaatgcatttcagctcgtcagcaatggaaagctgtcaattgaaaaagccttggat
ttaaccctgtacttgaaacgtgaaactgaaatcatgccggtgttccaaggtttgaatgag
ctgatacctatgtataagttgatggagaaaagagatatgaatgaagtggaaaatcaattc
aaggcctttctcatcaggctgctgagcgacctcattgacaatcagacgtggacggacgag
ggctcagtctcccagcgaatgctgcgcagtcagctgctgctgctcgcctgtgtgcgcaaa
tatcagccctgcgtgcagagggcggaagcctatttcagagagtggaaggacgccgatggg
aatctgagcctgcccagcgatgtgaccttggcagtgtttgctgtgggggtccaggaccct
gaaggatgggattttctttatagaaaatatcagtcgtctctgtcttcttccgagaaaaat
aaaattgaatttgccctcagtattagccaagataaggacaagcttcagtggctactagaa
gaaagttttaagggagatgtaataaaaattcaagagtttccacatattcttggagctatt
ggcaggaacccggtgggatatccattggcctggcagtttctgagggaaaattgggataaa
ctgatacaaaagtttgaacttggctcagcttccctaacctatatggtgataggaacaacg
agtcagttctccacaagagcacggcttgaagaggtaaaagaattcttcagctctttgaaa
gaaaagggttctcagctacgttgtgtccagcaaacaattgaaaccattggggaaaacata
cgttggatggataagaactttgagaagatccgagtgtggctacaaagcgagaagcttgaa
ctgctctaa

DBGET integrated database retrieval system