KEGG   Ursus maritimus (polar bear): 103672270
Entry
103672270         CDS       T03271                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchoring protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
umr  Ursus maritimus (polar bear)
Brite
KEGG Orthology (KO) [BR:umr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:umr01009]
    103672270 (AKAP5)
Protein phosphatases and associated proteins [BR:umr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     103672270 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 103672270
NCBI-ProteinID: XP_008699159
UniProt: A0A384CXF1
Position
Un
AA seq 424 aa
METTVSEIQVESKDEKRPTEVSPQDERQEERASVLCFKRRKKATKAMKPKASSEAAGTAR
KCPPEAGASDQPQPPGGAWASIKRLVTRRKRSESSKQQKPFEAKVQPEISAEDADVSKKK
AKSGLKIPCIKFSKGEKRSNHSKIIEDSDCSIRVQGEAEHLDTKDDQAAKTQLPQDVSKD
VSQKGGDEVCEPDVSNSTTTAGEKVISVELGLDTGHSAIHPGTLILERDTETIEEKQSVQ
GQQVSPLETSETEPQPPVVSEVPPPPASPDQQIVEDARSNILESGPNWKEHESREMIAEE
SELKDTELRQESELRENEVTAEKPKSEESKRMEPIAIIITDTEISEFDVKKSKNVPKQFL
ISIENEQVGVFANDSGFEGRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDDNKMN
NLLQ
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggaaaccacggtttccgaaattcaagttgaaagcaaggatgagaagagacccacagaa
gttagtcctcaagatgagaggcaggaggaaagagcatcagtgctttgcttcaagagaaga
aagaaagcaaccaaagcaatgaagcccaaagctagctctgaagctgctggtacagcaaga
aagtgtcccccagaagcaggagcttcagatcagccacagcccccagggggggcctgggcc
tcaatcaaacgtctggtgacacgcaggaaaaggtcagaatcttcaaagcagcaaaagccc
tttgaggctaaagtgcagcctgaaatcagtgctgaggatgctgatgtttctaagaaaaag
gcaaaatccggacttaagattccctgcataaaattctcaaaaggagagaaaagaagtaat
cattccaaaatcatagaagactcagactgcagcatcagagtccagggagaggctgaacac
ttggatacaaaagatgaccaggcagcaaagacccagttgccccaggatgtaagtaaagat
gtctcacagaaagggggtgatgaggtctgtgaaccagatgtgagcaacagcacaactaca
gctggagagaaagtgatttcagtagaacttgggttagatacagggcattctgccattcac
ccgggaacactaatccttgaaagagataccgaaacgattgaggaaaaacaaagtgtccaa
ggccagcaagtaagcccacttgaaacttcagaaacagaacctcagccaccagtggtttct
gaggttcctcccccacctgcaagcccagatcagcaaattgtagaagacgccagaagcaat
atcctcgaaagtggaccaaattggaaagagcatgaaagtagagagatgatagctgaagag
agtgagctgaaagatactgaattgcgccaggaatcagagctgagagaaaatgaggtcact
gcagagaaacccaaatcagaagaaagcaaaagaatggagccaattgctattattattaca
gacactgaaatcagtgaatttgatgttaagaaatctaaaaatgtccctaagcaattctta
atttcaattgaaaatgagcaagtaggggtttttgctaatgatagtggttttgagggtaga
acttcagaacaatacgaaacactcttaatagaaacagcttcttctcttgtcaagaatgct
atccaattgtctatagaacagctggttaatgaaatggcctctgatgataataaaatgaac
aatcttctacagtga

DBGET integrated database retrieval system