KEGG   Ursus maritimus (polar bear): 103673534Help
Entry
103673534         CDS       T03271                                 

Gene name
PLA2G4B
Definition
(RefSeq) phospholipase A2 group IVB
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00564  Glycerophospholipid metabolism
umr00565  Ether lipid metabolism
umr00590  Arachidonic acid metabolism
umr00591  Linoleic acid metabolism
umr00592  alpha-Linolenic acid metabolism
umr01100  Metabolic pathways
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04072  Phospholipase D signaling pathway
umr04217  Necroptosis
umr04270  Vascular smooth muscle contraction
umr04370  VEGF signaling pathway
umr04611  Platelet activation
umr04664  Fc epsilon RI signaling pathway
umr04666  Fc gamma R-mediated phagocytosis
umr04724  Glutamatergic synapse
umr04726  Serotonergic synapse
umr04730  Long-term depression
umr04750  Inflammatory mediator regulation of TRP channels
umr04912  GnRH signaling pathway
umr04913  Ovarian steroidogenesis
umr04921  Oxytocin signaling pathway
umr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103673534 (PLA2G4B)
   00565 Ether lipid metabolism
    103673534 (PLA2G4B)
   00590 Arachidonic acid metabolism
    103673534 (PLA2G4B)
   00591 Linoleic acid metabolism
    103673534 (PLA2G4B)
   00592 alpha-Linolenic acid metabolism
    103673534 (PLA2G4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103673534 (PLA2G4B)
   04010 MAPK signaling pathway
    103673534 (PLA2G4B)
   04370 VEGF signaling pathway
    103673534 (PLA2G4B)
   04072 Phospholipase D signaling pathway
    103673534 (PLA2G4B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103673534 (PLA2G4B)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103673534 (PLA2G4B)
   04664 Fc epsilon RI signaling pathway
    103673534 (PLA2G4B)
   04666 Fc gamma R-mediated phagocytosis
    103673534 (PLA2G4B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103673534 (PLA2G4B)
   04913 Ovarian steroidogenesis
    103673534 (PLA2G4B)
   04921 Oxytocin signaling pathway
    103673534 (PLA2G4B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103673534 (PLA2G4B)
  09156 Nervous system
   04724 Glutamatergic synapse
    103673534 (PLA2G4B)
   04726 Serotonergic synapse
    103673534 (PLA2G4B)
   04730 Long-term depression
    103673534 (PLA2G4B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103673534 (PLA2G4B)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    103673534 (PLA2G4B)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     103673534 (PLA2G4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 103673534
NCBI-ProteinID: XP_008700540
UniProt: A0A384D1A8
Position
Un
AA seq 899 aa AA seqDB search
MPAASPAQLGISDGESGEVIRRCQTGLGGAPRKLPHSSRAASGVWGPEGHPCFSHNKDRQ
EGTETPAPAQTCKIPLPRMPPRGLIILATQLRGWRQLWTQLGGLWVGGSHVAGQGWYLWF
RISPGGVSLPSSLTFDSFGLSSLQQACPLPLQARVPGTCLLTVRVLQAHGLPSKDLVTPS
DCYVSLWLPTAXRTVKNSRNPIWNQSFRFRIHSQLKNVLQLQVFDQDLLTSDDPVLSVLF
DLGTLQAGDFRRESFSLNPQGEERLEVEFRLQRLTDCAEQLVSNGILVARELFCLHVRLE
EAGDRKQSEGRVQLVVPGSCEGQQEASVGAGPFCFHCPACWEQELGILLQDAPQEQLKVP
LRALPSGQVVRLVFPTSQEPLMRVELRKEEGPRELAVRLGCGPCAEEQAFLSRRKQVVAG
ALKQALQLDDDLREDEIPVVAVMATGGGIRAMVSLYGQLAGLRELGLLDCISYITGASGS
TWALANLYEDPEWSQKDLAGPTESLKTQVTKNKLGVLAPSQLQRYRQELAERARLGHPTC
FTNLWALISEALLHDEPHDHTLSDQREALSRGQNPLPIYCALNTKEKNLTTFEFGEWCEF
SPYEVGFPKYGAFIPSELFGSEFFMGRLTKRLPESRICFLEGIWSNLYAANLQDSLYWAS
EPSQFWDRWAQDQANLEKEQVPLLKIEEPPTGTGRIAEFFTDLLTRRPLAQATHNFLRGL
HFHKDYFHHPYFSAWKATKLDGLPNQLTPAEPHLCLLDVGYLINTSFPPLLRPTRDVDLV
LSLDYNLEGAFQQLQLLGRLCQEQGIPFPPISPSPEEQRQPRECHLFLDPDCPDAPAVLH
FPLVDDSFRHYSAPGLPRTPEEEEAGEIDSPLFKQGEHSGVRWLPKVDVGDNGLSPKQY
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atgccggctgccagcccagctcagcttgggatcagcgatggagaatctggggaggtgatc
aggaggtgccagacaggtctgggtggggctcccaggaagttgccacacagctccagggca
gctagtggggtctggggccccgagggtcacccctgcttctcccacaacaaggacaggcag
gaggggacagagacccctgcacccgcccagacctgcaagatcccccttccccgaatgcca
cccagaggcctcatcatcctggccacccagctccgagggtggaggcagctgtggacgcag
cttggagggctgtgggtggggggcagccatgtggctgggcagggctggtacctttggttc
aggattagtcctggaggggtctccctgccctcttctttgacctttgactcctttgggctc
agcagcctgcagcaagcctgtcctctccctctgcaggcaagggttcctgggacctgcctg
ctcactgttcgtgtcctgcaggcccatggcctgccctcgaaggacctagtgaccccctct
gactgctatgtgagtctgtggctgcccacggccncccgcacggtcaagaacagcagaaac
cccatttggaatcagagctttcgctttcgaatccacagccagcttaagaatgtcttgcag
ctgcaagtctttgaccaggaccttctgaccagtgatgaccccgtgttgtcagtgctattt
gacttggggactttgcaggctggggacttccgccgagagagcttctcactgaaccctcag
ggtgaggagcggctggaagttgaatttcggctgcagagactaacagactgtgctgagcag
cttgtcagcaatggcatcctggtggcccgggagctcttctgcttgcacgtccgactggag
gaggcaggggaccggaagcagtcagagggcagagttcagcttgtggttcctgggtcctgc
gagggtcaacaggaggcctccgtgggtgctggccccttctgcttccattgcccggcctgc
tgggagcaggagctgggtattcttctgcaggatgcccctcaagagcaactgaaggtgccc
ctgcgggccttgccctctggccaagtggtcaggctggtcttccctacatcccaggagccc
ctgatgagagtggagctgagaaaagaagaaggaccgagggagctggcggtgcggctgggc
tgtggcccctgtgcggaggagcaggccttcctgagcaggaggaagcaggtggtggccgga
gccctgaagcaggccctgcagctggatgacgacctgcgggaagacgagatccccgtggta
gctgtcatggccaccggcggtgggatccgggcgatggtttccctctacggacagctggcc
ggactgagggagctgggtctcttggactgcatctcctacatcacaggggcctcgggctcc
acctgggctttggccaacctctatgaggacccagaatggtctcagaaggacctggcaggg
cccaccgagtccctgaagacacaggtgaccaagaacaagttgggcgtgctcgcccccagc
cagctgcagcggtaccggcaggagctggccgagcgtgcccgcctgggccacccgacctgc
ttcaccaacctgtgggccctcatcagcgaggcactgctgcacgatgagccccatgaccac
acactttcagaccagcgggaggccctgagtcgtggccagaaccctctgcccatctactgt
gcccttaacaccaaggagaagaacctgaccacctttgagtttggcgagtggtgcgagttc
tccccctatgaggtcggctttcccaaatacggggccttcatcccctctgaactcttcggc
tctgagttcttcatggggcgcctgaccaagcggcttcctgagtcccgaatctgcttcctt
gaaggtatctggagcaacctgtatgcagccaacctccaggacagcttatactgggcctca
gagcccagccagttctgggaccgctgggcacaggatcaggccaacctggagaaggagcag
gtcccacttctgaagatagaagagcctcccacgggcaccggcaggattgctgagtttttc
actgaccttctgacacggcgcccactggcccaggccacacacaatttcctgcggggcctc
catttccacaaggactatttccatcatccttacttttccgcctggaaagccaccaaactg
gatgggctccccaaccagctgacacctgcggagccccacctttgtctgctggatgttggc
taccttatcaacaccagcttcccgcccctcctgcggcccacgcgggatgtggacctcgtc
ctgtcgctggattacaacctcgaaggagcctttcagcagctgcagctcctgggccggctg
tgccaggagcagggcatccctttcccgcccatctcacccagccctgaggagcagcgccag
cctcgtgagtgccacttgtttctggacccagactgccccgacgcccccgctgtgctgcac
ttccctctggtcgatgactccttccggcactactcggcccctggcctcccgcggacccct
gaggaggaggaggccggggagatagatagccccctcttcaagcaaggagaacattcaggg
gttcgttggttgcccaaggtcgatgtgggggacaacggcttgagcccaaagcagtattga

DBGET integrated database retrieval system