KEGG   Ursus maritimus (polar bear): 103676308Help
Entry
103676308         CDS       T03271                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04066  HIF-1 signaling pathway
umr04068  FoxO signaling pathway
umr04072  Phospholipase D signaling pathway
umr04150  mTOR signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04152  AMPK signaling pathway
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr04520  Adherens junction
umr04910  Insulin signaling pathway
umr04913  Ovarian steroidogenesis
umr04923  Regulation of lipolysis in adipocytes
umr04930  Type II diabetes mellitus
umr04931  Insulin resistance
umr04932  Non-alcoholic fatty liver disease (NAFLD)
umr04960  Aldosterone-regulated sodium reabsorption
Module
umr_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103676308 (INSR)
   04015 Rap1 signaling pathway
    103676308 (INSR)
   04010 MAPK signaling pathway
    103676308 (INSR)
   04066 HIF-1 signaling pathway
    103676308 (INSR)
   04068 FoxO signaling pathway
    103676308 (INSR)
   04072 Phospholipase D signaling pathway
    103676308 (INSR)
   04022 cGMP - PKG signaling pathway
    103676308 (INSR)
   04151 PI3K-Akt signaling pathway
    103676308 (INSR)
   04152 AMPK signaling pathway
    103676308 (INSR)
   04150 mTOR signaling pathway
    103676308 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103676308 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103676308 (INSR)
   04923 Regulation of lipolysis in adipocyte
    103676308 (INSR)
   04913 Ovarian Steroidogenesis
    103676308 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103676308 (INSR)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    103676308 (INSR)
   04213 Longevity regulating pathway - multiple species
    103676308 (INSR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    103676308 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    103676308 (INSR)
   04931 Insulin resistance
    103676308 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103676308 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:umr04090]
    103676308 (INSR)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103676308 (INSR)
Protein kinases [BR:umr01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   103676308 (INSR)
CD molecules [BR:umr04090]
 Proteins
  103676308 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Furin-like Pkinase fn3 Kinase-like B2
Motif
Other DBs
NCBI-GeneID: 103676308
NCBI-ProteinID: XP_008703688
Position
Un
AA seq 1392 aa AA seqDB search
MGKQGVCAGEIRLHTREAGPATHSYNPSIACLLTCLAFCLFSLLVCPGMDIRNNLTRLHE
LANCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVI
RGSRLFFNYALVIFEMVHLKELGLYSLMNITRGSVRIEKNNELCYLATIDWSRILDSVED
NYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCT
AEGLCCHSECLGNCSEPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDL
HNKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLGPCPKVCHILEGEKTID
SVTSAQELRGCTVVNGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFF
RKLRLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKM
EEVSGTKGRQERNDIALKTNGDQASCENELLKFSYIRTSYDKILLKWEPYWPPDFRDLLG
FMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWTQY
AIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPN
GNITHYLVFWERQAEDSELYELDYCLKGLKLPSRTWSPPFEAEGSQKHNQSEYEESAGEC
CSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKSSSSPGAEDTRPSRKRRALGDVAN
VTAAPPTVPGFPNTSTSAPTSPEEHKPFEKVVNKESLVISGLRHFTGYRIELQACNQDSP
EERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRR
YGDEELHLCVSRRHFALERGCRLRGLPPGNYSVRVRATSLAGNGSWTEATYFYVTDYLDV
PSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSV
YVPDEWEVPREKITLLRELGQGSFGMVYEGNARDVVKGEAETRVAVKTVNESASLRERIE
FLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMAEDGVSWLRGPGKAPAPSRRNNPGRPP
PTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYY
RKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVM
DGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVDLLKDDLHPSFPEVSFFHSEENK
APESEELEMEFEDMESVPLDRASHSQREEAGGRDGGSSLGLKRNYEEHIPYTHMNGGKKN
GRILTLPRSNPS
NT seq 4179 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagcagggtgtctgtgcaggggagatcaggttacacacccgtgaagctggccct
gccactcactcttataacccatccatcgcatgtttgctcacctgtcttgctttctgcttg
ttttcacttctagtgtgtcctggcatggatatccggaacaacctcacgaggttgcatgag
ctggccaactgctcagtcatcgaaggacatttgcagatactgttgatgttcaaaacgagg
cccgaggatttccgagacctcagtttccccaaactcatcatgatcaccgattacttgctg
ctcttccgggtctacgggctggagagcctgaaggacctgttccccaacctcacggtcatc
cggggctcgcgcctcttcttcaactacgcgctggtcatcttcgagatggttcacctgaag
gagcttggcctctatagcttgatgaacattaccaggggctccgtccgcatcgagaagaat
aatgagctctgctacctggccaccatcgactggtcacgcatcctggattccgtggaggat
aattacattgtgctgaacaaagacgacaatgaggagtgtggggacatctgtccaggcact
gcaaagggcaagaccaactgcccggccactgtcatcaacgggcagtttgtcgagaggtgt
tggacacacagccactgccagaaagtttgtcccaccatctgcaagtcgcacggctgcacc
gccgagggcctctgctgccacagcgagtgtttaggcaattgctccgagcccgatgacccc
accaagtgcgtggcctgtcgcaacttctacctggatggcaggtgcgtggagacctgcccg
cccccgtactaccacttccaagactggcgctgcgtgaacttcagcttctgccaggatttg
cacaacaaatgcaagaactcccggagacagggctgccaccagtacgtcattcacaataac
aagtgcatccccgagtgcccctctggctacacgatgaattccagcaacctgatgtgcacc
ccatgcctgggcccctgtcccaaggtctgccacatcctggagggcgagaagaccatcgac
tcggtgacctctgcccaggagcttcgaggctgcactgttgtcaacggaagcctcatcatc
aacattcgagggggcaacaacctggcagctgagctggaggccaacctcggactcattgaa
gaaatttccgggtatctgaaaatccggagatcctacgctcttgtgtccctttcctttttc
cggaagttacggctgattcgaggagagaccttggaaatcgggaactactctttctacgcc
ttggacaaccagaacctaaggcagctgtgggactggagcaaacacaacctcaccatcact
caggggaagctcttcttccactataatcccaaactctgcttgtcggaaattcacaagatg
gaggaagtttcaggaaccaaggggcgccaggagaggaacgacattgccctgaagaccaat
ggggaccaggcgtcttgtgaaaacgaactccttaaattttcttacattcggacatcatat
gacaagatcttgctgaaatgggagccatactggccccctgacttccgagacctcctgggc
ttcatgcttttctacaaagaggccccttatcagaatgtgaccgagttcgacgggcaggac
gcgtgtggctccaacagctggacggtggtggacattgacccgcctttgcggtccaatgac
cccaagtcacagaaccacccagggtggctgatgcggggtctcaagccctggacccagtat
gccatctttgtcaagaccttggtcaccttttctgatgaacgccgcacgtacggggccaag
agtgacatcatctatgtgcagacagatgccactaacccttccgtccccctggatccaatc
tccgtctcgaattcctcatcccagattattctgaagtggaagcctccctctgaccccaat
ggcaacatcacacactacctggttttctgggagaggcaggcagaagacagtgagctgtat
gaattggattattgcctcaaagggttgaagctgccctcccgcacctggtctccgccgttc
gaggccgagggctcgcagaagcacaaccagagtgagtacgaggagtctgccggcgagtgc
tgttcctgccccaagacggactctcagatcctcaaggagctggaggagtcctcgttcagg
aagaccttcgaggattacctgcacaatgtggtgttcgtccccagaaaatcctcttcaagc
cctggtgctgaggacactaggccatcgcggaaacgcagggccctcggtgacgttgccaat
gtgacggcggccccgcccacggttccgggtttccccaacacctccaccagcgcacccacg
agcccggaggagcacaagcccttcgagaaagtggtgaacaaggaatccctggtcatctct
gggctgcgtcacttcactggctaccgcatcgagctgcaggcttgcaaccaagactcccca
gaggagaggtgcagcgtggcggcttatgtcagcgccaggaccatgcccgaagctaaggca
gacgacattgttggccccgtgacccacgaaatcttcgagaacaacgttgttcacttgatg
tggcaggagccaaaggagcccaacggtctgatcgtgttgtatgaagtgagttaccgacgc
tacggtgatgaggagttgcacctctgtgtctcccgcagacactttgctctggagcggggc
tgcaggctgcgcgggctgccgccggggaattacagcgtgcgagtccgggccacctccctg
gccggcaacggctcctggacagaagccacttacttctacgtgacagactatttagatgtc
ccatcgaatattgcaaaaatcatcatcggccccctcatctttgtctttctcttcagtgtt
gtgattggaagtatttacctgttcctgagaaagaggcagccggatgggccactgggaccg
ctgtatgcttcttcaaaccctgagtacctcagtgcgagtgatgtgtttccatgttctgtg
tatgtgccggacgagtgggaggtcccccgggagaagatcactctgctgcgtgagctgggg
cagggctccttcggcatggtgtacgaaggcaacgccagagacgtcgtcaagggcgaggcg
gagacccgcgtggcggtgaagacggtcaatgagtcggccagtctgcgggagaggatcgag
tttctcaacgaggcctcggtcatgaagggcttcacctgtcatcacgtggtccgcctcctg
ggggtggtgtccaagggccagccgacgctggtggtgatggcggaggatggggtgagctgg
ctccggggacccggcaaggcgcccgctcccagccgccggaataaccccggccgccctccc
cctaccctgcaagagatgattcagatggcggcggagatcgccgacgggatggcctacctg
aacgccaagaagttcgtgcaccgggatctcgcggcccgaaactgcatggtcgcccacgac
ttcaccgtcaaaattggagactttgggatgaccagagacatctatgaaacggattactac
cggaaaggaggcaagggtctgctccccgtgcggtggatggccccggaatcgctgaaggac
ggggtctttaccacttcttctgacatgtggtcctttggcgtggtcctttgggaaatcacc
agcttggcagaacagccataccagggtctgtctaatgaacaggtgttgaaattcgtcatg
gatggagggtatctggatcaacccgacaattgtccagagagagtcaccgacctgatgcgc
atgtgctggcagttcaatcccaagatgcggcccaccttcctggagatcgtcgacctgctc
aaggacgacctgcaccccagctttccggaagtttccttcttccatagcgaggagaacaag
gcgcctgagagcgaggagctggagatggagttcgaggacatggagagtgtccccctggat
cgggcctcacactctcagagggaggaggccgggggccgggatggagggtcctccctgggc
ctcaagcgaaactacgaggagcacatcccctacacccacatgaacgggggcaagaaaaac
ggacggattctgactctgccgaggtcgaatccttcctaa

DBGET integrated database retrieval system