KEGG   Ursus maritimus (polar bear): 103677270Help
Entry
103677270         CDS       T03271                                 

Gene name
AURKC
Definition
(RefSeq) aurora kinase C
  KO
K11480  aurora kinase C [EC:2.7.11.1]
Organism
umr  Ursus maritimus (polar bear)
Brite
KEGG Orthology (KO) [BR:umr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103677270 (AURKC)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:umr03036]
    103677270 (AURKC)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103677270 (AURKC)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: AGC group
  AUR family [OT]
   103677270 (AURKC)
Chromosome and associated proteins [BR:umr03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     103677270 (AURKC)
  Sister chromatid separation proteins
   Aurora kinases
    103677270 (AURKC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 103677270
NCBI-ProteinID: XP_008704763
UniProt: A0A384DCL5
Position
Un
AA seq 334 aa AA seqDB search
MNSGGVHAAGEGERTQDQRKGCKGLVSSSGVEAAPKEVSTSVCLTHAAAAGHVELSIPPV
RRLTIDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQ
AHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKKLQKSHTLDEQHTATIMEELADALT
YCHEKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEMIERRI
YDEKVDLWCIGVLCYELLVGNPPFESPSHNETYRRILKVDVRFPSSLPLGAQDLISRLLR
YQPSERLPLAQILEHPWVRAHSQRVFPPSVQMAS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaattcgggcggtgttcatgccgcaggtgaaggggagaggacccaggaccagaggaaa
ggttgcaaagggctggtgtcgtcgtcgggggtggaggctgcaccgaaggaagtgtcgacc
tctgtctgtctgactcacgcagctgcagcaggccacgtggagctcagcatcccgcccgtg
cggcgcctcacaattgatgactttgaaatcgggcgtcctctgggaaagggaaaatttggg
aatgtgtacctggctcggctcaaggaaagccattttatcgtggccctgaaagtcctcttc
aagtcccagatagaaaaggaaggactggagcaccaactgcgcagggaaattgaaatccag
gcgcatctacaacaccccaatatcctacgcctatacaactatttccatgatgcccgccgc
gtgtacctgattctggaatatgctccaaggggtgagctctacaagaagctgcagaagagc
cacacattggatgaacagcacacagccacgataatggaggaattggcagatgctctgacc
tactgccacgagaaaaaggtgattcacagggatattaagccggagaacctactgctgggg
ttcaggggtgaggtgaagattgcagactttggctggtctgtgcacaccccatctctgagg
agaaagacaatgtgcgggactctggactacttgcccccagaaatgattgaaagaagaata
tacgatgagaaggttgatctgtggtgcattggagtgctgtgctatgagctgctggtggga
aatccaccctttgagagcccttcccataatgagacctacagacgcatcctcaaggtagat
gtaaggtttccctcatcattacctttgggggcccaggacttgatctccaggcttctcaga
taccagccttccgagcggctgcccttggcccagatcctagagcacccctgggtccgggcc
cactctcagagggtgttccctccatctgttcagatggcttcttga

DBGET integrated database retrieval system