KEGG   Ursus maritimus (polar bear): 103679270
Entry
103679270         CDS       T03271                                 

Gene name
AHRR
Definition
(RefSeq) aryl-hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
umr  Ursus maritimus (polar bear)
Brite
KEGG Orthology (KO) [BR:umr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103679270 (AHRR)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    103679270 (AHRR)
SSDB
Motif
Pfam: PAS HLH
Other DBs
NCBI-GeneID: 103679270
NCBI-ProteinID: XP_008706998
UniProt: A0A384DIZ5
Position
Un
AA seq 841 aa
MELSGRFYIRKRKPVGSEVQGHKGEGWEEEEDPPQTPPREGARGPCQRNSPARTLMQQTA
LWYLSCVYCSWMPIEWLLLSEHRLRIFIYRPEMMIPPGECMYAGRKRRKPIQKQRPATGA
EKSNPSKRHRDRLNAELDHLASLLPLPPDIVSKLDKLSVLRLSVSYLRVKSFFQAVQKCP
RTPAASAPSPAPSAEDSGLSGRSAVLEGRLLLESLDGFALVVSAEGMIFYASATIVDYLG
FHQGLNLGKHGLVCLFHAQNSLQLLPLSAELPCEFSRHTQSRLPPAIIRRAQTDVMHQNI
YDYIHVDDRQDFCRQLHWAMDPPQVVFGQPLHSETDKTKVSPSFIIMSEGMTNSEMESYS
WNSPPRFSDPTMQFQGKLKFLFGQKRKTPSGIVLPPRLSLFCIVVPVLLPSVAEMKMKSA
FLRVKHRVDVSASMDAKARVAASQCDPEFRGKPSYFAGRNNGENIPVLRTQADTGRWARV
PARAPCLCLRNGPDLISDPEGAPGDRGGEEHGRVPGVSSAARGRREIHAHGCCFEAPGPV
KHLSWMTGRHGQDGGSKLKLEPSRSDPFSMHAVSLGSCAPCPGVQGAVNTSGVTAFRNPP
SCHPGSNSPSAYASRTSRALRDSDQGQAHPPPSCPFPRGSLDSGLPQPRGQRLTAAGYSI
EDTKFRGGPVPSGAPCNPILSLDVPIKMESDSGSEDATDGYSLSPRQAWLGASGMTEPEA
KHHLYAPHLEHSLLEAHPSVRAPLRPGRELAPFHPAHCACLERGHGLPEPDPPHHFCAQG
HQPPTLGCDCRAPGTAPIVKREPLDSPPWASHSQGGVPGMFPKSAVATLMPPKAPECAFL
P
NT seq 2526 nt   +upstreamnt  +downstreamnt
atggagttgagtgggagattttacatacgaaagaggaagcctgttggctcagaagtacag
ggccataaaggggagggttgggaagaggaagaagacccaccacaaacaccaccaagagag
ggtgcacgcggcccctgccagaggaacagccccgccagaacgctgatgcagcaaactgct
ctttggtaccttagctgtgtgtactgctcgtggatgcccatagaatggcttctactttct
gagcacaggctcaggatatttatctaccggccagagatgatgatcccaccaggggagtgc
atgtatgctggaaggaaaagaaggaagcccattcagaaacagaggcctgccacgggggct
gagaagtcaaacccttccaagcggcaccgggaccgtctcaacgccgagctggaccacctg
gccagcctactgcctcttcctccagacatcgtgtctaagctggacaagctttccgttctg
cgtctcagtgtcagctacctcagggtgaagagcttcttccaagccgtgcagaagtgtcca
cggacgccggcggccagtgccccctcacctgccccctcagccgaagacagcggtctgagc
ggaagatccgcggtgctggagggaaggctgctgctggagtctctcgatggcttcgccctg
gtcgtgagtgcggaaggcatgatattttatgcttcagcaacaatcgtggactatctgggc
ttccaccagggtctaaatctaggaaaacatggtctggtctgccttttccatgctcagaat
tcccttcagctcctaccactgtctgctgaattgccctgtgaattctccagacacacccag
agccgcctgcctccagccataatccggagggctcagaccgatgtgatgcaccaaaacatt
tacgactacatccacgtggacgaccgccaggacttctgccggcagctccactgggccatg
gaccctccccaggtggtgtttgggcagcccctgcactcagagacagataaaaccaaggtg
tccccgagctttatcatcatgagtgaaggaatgacaaattctgaaatggagagttacagc
tggaacagccctccgagattttctgatccgacgatgcagtttcaaggaaaactaaaattc
ctgtttggacagaagaggaaaacgccatcggggatagtcctgccccctcggctctcactg
ttctgcatcgtggtgcctgtcctcctaccttccgtggcggagatgaaaatgaagagtgcg
tttttgagggtgaagcacagggtggacgtctcagcctcgatggatgcaaaagcaagagtg
gccgcgagtcagtgcgacccagaattccgtgggaaacccagttacttcgcagggaggaac
aacggagaaaacattccagtgctcaggacacaagcggacacgggacgctgggcccgggtt
ccagccagggccccatgcctgtgcctcagaaatggccccgacctcatttctgaccctgaa
ggggccccaggggacaggggaggagaagagcacggcagggtgcccggcgtctcctcagca
gccagggggcggagggaaatacatgcacacggttgctgcttcgaggcacccggacccgtg
aagcacctgagctggatgacggggcgacacggccaggacgggggcagcaagctgaagctg
gagcccagcaggagtgacccgttctccatgcatgctgtgtcccttggctcctgcgcgccc
tgcccaggcgttcagggtgccgtcaacaccagtggggtaactgctttcaggaatcccccc
agctgtcacccaggaagcaattctcccagcgcctatgccagccgcaccagcagagctttg
cgggacagcgatcagggccaggcgcaccctccacccagctgccccttcccccgggggagc
ctggacagtgggctccctcagcccagagggcaacgtctcacagcggcgggctattccatc
gaggacaccaagtttcgaggtgggccagtgccctcgggagctccgtgcaaccccatcttg
tcacttgatgtgcccatcaagatggagagtgactctgggtctgaggatgccacagatggc
tactccctatccccgcgccaggcgtggctgggagccagcggtatgacagagccggaagcc
aagcaccacctgtacgctccgcacctggagcacagcttgttggaggctcacccgagcgtc
agggctccactcagacctggcagggagctggcccccttccaccccgcgcactgtgcctgc
ctggagcgtgggcatggccttcctgagccagatcctccccaccacttctgtgcacagggt
caccagccccccacactgggctgtgactgccgagctccggggactgcgcccatcgtcaaa
cgggagcccctggactccccgccatgggccagtcacagccagggcggggtgcccggaatg
ttccccaaaagtgccgtggcaacgctgatgcctcctaaagcccccgagtgtgctttcctg
ccataa

DBGET integrated database retrieval system